(data stored in ACNUC7421 zone)

EMBL: CP000272.PE501

CP000272.PE501       Location/Qualifiers
FT   CDS_pept        547247..547987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0529"
FT                   /product="Putative NADH dehydrogenase subunit"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36429"
FT                   /db_xref="GOA:Q13HL0"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR016214"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL0"
FT                   /protein_id="ABE36429.1"
FT                   /translation="MSTPANAGNTNGTSHAFPLDGEDVPFEPGDTILQAARRAGRYIPH
FT                   LCWHPDFHPQGSCRVCTVKVKGRPGSACTMHAADGQKVESNTDELNAERKMLLQMLFVE
FT                   GNHFCPSCEKSGNCLLQATAYEMNMEGVLFDEFYPRRPIDASHPDVMIDFNRCILCELC
FT                   VRASHDIDGKDVFAIAGHGSGTHLVVNSVSGRLADTEMDLADRATSICPVGAILPKRRG
FT                   FLIPIGERRYDPQTAADPDTQEAS"
     atgagcacac ctgccaacgc gggcaatacc aacggtacca gccacgcttt cccgctcgat        60
     ggagaggacg tcccgttcga gcctggcgac accatcctgc aagccgcacg gcgggctggc       120
     cgttatatcc cacacctgtg ctggcatccg gattttcatc cgcagggttc gtgccgtgtg       180
     tgcaccgtga aggtcaaggg ccgccctggc tcggcctgca cgatgcacgc cgctgatggg       240
     caaaaagtcg aaagcaatac cgacgagctg aacgcggagc gaaagatgct gctgcagatg       300
     ctgttcgtcg agggcaatca cttttgcccc tcctgcgaaa aaagcggcaa ctgcctgctg       360
     caagcgacgg cctacgagat gaacatggag ggcgtgctgt tcgacgagtt ctatccgcgc       420
     cggccgatcg acgccagcca ccccgacgtc atgatcgact tcaaccgctg cattctgtgc       480
     gagctctgcg tgcgggcgag tcacgacatc gacggcaagg acgttttcgc cattgccggg       540
     cacggcagcg gcacccacct ggtggtcaac agcgtcagtg gaaggctcgc cgacaccgag       600
     atggatctcg ccgaccgggc caccagcatt tgcccggttg gggcgatcct gccgaagcgg       660
     cggggcttcc tgatcccgat tggcgagcgc cgatacgacc cgcagacggc cgccgatccc       720
     gacacgcagg aggcgtcatg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page