(data stored in SCRATCH zone)

EMBL: CP000272.PE503

CP000272.PE503       Location/Qualifiers
FT   CDS_pept        548593..550107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0531"
FT                   /product="NAD(P)-dependent nickel-iron dehydrogenase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36431"
FT                   /db_xref="GOA:Q13HK8"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK8"
FT                   /protein_id="ABE36431.1"
FT                   /translation="MSFDLETAANPKGLRRVAIDPVSRVEGHGKVTILLDEQQRVQQVR
FT                   LHIVEFRGFEKFIEGRPYWEVPVMVQRLCGICPVSHQLAASKAMDRVVGARPVTRSAEK
FT                   IRRLMHYGQVMQSHALHFFYLASPDLLFGFDSEVDLRNIVGVAQAYPDIAKQGILLRKF
FT                   GQELIRATSGKRIHGTGSIPGGMNRYVSQADRDMLYRDVDQMTGWAADAVDIAKQLHAQ
FT                   NPALYDSFGSFRSNMLSLVRADGAMDLYDGVLRARDADGGIIFDGASDQDYMSLIEEET
FT                   RPWTYMKFPHLRSLGRDTGWYRVGPLARVQNCDFIPSPLAEAQRKEFVDWGKGSPVHAT
FT                   LAYHWARMIEVLHAVEVIKDLLDDPDILQGELMASGERRAGGVGIIEAPRGTLIHDYRV
FT                   NADDLVTHCNLIVSTTHNNQAMNEAVRSVAREYLDGQRLTEGLLNRIEIAIRAFDPCLS
FT                   CATHALGRMPLDVVLLGPGGEPFDHMTKSHDGEVMRHSPAGMGAMA"
     atgagcttcg acctcgaaac ggccgccaat ccgaaaggat tgcggcgtgt ggccatcgac        60
     ccggtatcgc gcgtcgaagg gcacggcaag gtgacgatcc tgctggacga gcagcagcgc       120
     gtgcagcagg tgcgtttgca tatcgtcgag ttccgcggct tcgagaagtt catcgaaggg       180
     cggccgtact gggaggttcc ggtgatggtg cagcgtctat gcggcatctg cccggtgtcg       240
     caccagcttg cggcgtccaa ggcgatggat cgggtcgtgg gcgcacggcc ggtcacccgc       300
     agcgcggaga aaatccggcg gctgatgcac tacggtcagg tcatgcagtc gcatgcgttg       360
     cacttcttct acctggcatc gcccgatctt ctgttcggct tcgattcgga ggtcgacttg       420
     cgcaatatcg tcggcgtggc gcaggcgtat cccgacatcg cgaaacaggg catcctgctg       480
     cgcaaattcg ggcaggagct gatccgggcc acctcgggca agcgtatcca cggcaccggt       540
     tccataccgg gtggcatgaa ccggtatgtc agccaggcgg accgcgacat gctgtaccgg       600
     gacgtcgatc agatgaccgg ttgggcggcc gatgccgtgg acatcgccaa acagcttcac       660
     gcgcagaatc cagccctcta tgacagcttc ggcagctttc gttcgaacat gctgtcgctg       720
     gtgcgcgcgg acggcgcaat ggatctctac gacggtgtac tgcgcgcccg cgacgccgac       780
     ggtgggatca ttttcgacgg tgcgagcgat caggactata tgagcctgat cgaagaagaa       840
     acgcgcccct ggacctacat gaagtttccg catctgcgca gcctcggacg cgataccggc       900
     tggtatcgcg tcggaccgct ggcgcgcgtg cagaactgcg acttcatccc cagtccgctg       960
     gccgaagcgc agcgcaagga gttcgtcgac tggggcaagg gctcgccggt tcatgcgacg      1020
     ctcgcctacc actgggcccg catgatcgag gtcttgcacg cggtggaggt catcaaggat      1080
     ctgctcgacg atcccgatat ccttcagggt gagttgatgg cgagcggcga gcgccgcgcc      1140
     ggcggggtgg ggatcatcga agcgccgcgc ggcacgctga ttcacgacta tcgcgtgaat      1200
     gccgacgatc tcgtcacgca ctgcaacctg atcgtctcca cgacgcacaa caaccaggcc      1260
     atgaacgagg ccgtgcgctc ggtggcacgc gaatacctgg atggccagag gttgaccgag      1320
     ggcctgctca accgcatcga aatcgcgatc cgtgcgttcg acccgtgcct gtcctgcgcc      1380
     acccacgcat tgggacggat gccgctggat gtcgtgctgc tgggacctgg cggcgagccg      1440
     ttcgaccaca tgacgaagtc gcacgacggc gaggtgatgc gccattcgcc ggcaggcatg      1500
     ggagcgatgg catga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page