(data stored in ACNUC7421 zone)

EMBL: CP000272.PE504

CP000272.PE504       Location/Qualifiers
FT   CDS_pept        550104..550598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36432"
FT                   /db_xref="GOA:Q13HK7"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK7"
FT                   /protein_id="ABE36432.1"
FT                   /translation="MNAPLLIFGWGNLSRGDDALGPLFVQQLRLLAGTGAGSRVDFLED
FT                   YQLQIEHALDLAFRERVLFVDGSVNCATPFEVTALRPSRDTSFTTHAISPQAVMHVYRD
FT                   LYHAEPPACTLLAIRGMHFELGAPPGSLALDHLARALAWGQSWIERRAVAPSGLSGIAH
FT                   A"
     atgaacgcac cgctgctgat attcggatgg ggcaatctga gccgcgggga cgacgcactc        60
     ggtccattgt tcgtgcagca actgcgcctg ctggctggga ccggggccgg cagccgggtg       120
     gatttcctgg aggactacca gttacagatc gaacatgcac tcgatctggc ttttcgcgag       180
     cgcgtgctgt tcgtggacgg cagcgtcaat tgcgcgacgc ctttcgaggt gaccgcactg       240
     cgcccatcgc gcgacaccag ctttacgaca cacgcgattt cgccgcaagc agtgatgcac       300
     gtgtatcggg acctgtacca cgccgaaccg cctgcgtgca cgctgctggc catacgcggc       360
     atgcatttcg aattaggggc gccccccggt tccctcgcgc tcgatcatct ggctcgcgcg       420
     ttggcatggg gccagtcctg gatcgaacgg cgcgcggtgg cgccttccgg cttgtccggg       480
     atcgctcatg catga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page