(data stored in ACNUC7421 zone)

EMBL: CP000272.PE507

CP000272.PE507       Location/Qualifiers
FT   CDS_pept        551866..554304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0535"
FT                   /product="Hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36435"
FT                   /db_xref="GOA:Q13HK4"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK4"
FT                   /protein_id="ABE36435.1"
FT                   /translation="MPTRVHTVRDDEPLVSKWGGEAIRVRGLVQGVGFRPAVWRLAHDC
FT                   GVSGTVCNDGEGVLIRAWADRPVLERFVAGLHGRCPPLGRIDSVERRAVPDVAPAPGEF
FT                   TIVESGGGPAHTGVVPDAVTCRACLDETLDPSGRRYRYPFTNCTHCGPRLSIVGAIPYD
FT                   RCATTMAAFPLCGACRREYDDPGDRRFHAQAVACPACGPRIWIEQADGSRERGDPLEVA
FT                   CRYLRLGGIVAIKGLGGFQLACMATAQAAVTKLRVLKHRARKPFALLARDVTMAERYCS
FT                   VSNADAALLRSAAGPIVIMPAIGRTTAADLSGVAPGTATLGFMLPSTPLHHLIMRALDA
FT                   PIVLTSGNVADEPQCTANDDARIRLAGMADVFLMHDREIASRIDDSVARVLHGVPRLLR
FT                   SSRGYAPAPLRMPHDFAAAPPVLAMGAQQKNAFCLLREGEALVSHHIGELENGETYRDY
FT                   KASLARYEKLFGHDARVVAVDLHPEYLSRKLGIDIARQRSLPLAEIQHHHAHFAACLAE
FT                   NDIGLASNILGVVLDGHGMGTDRRLWGGEFLLGGYVDCTRVASLTPVALPGGMRAVLEP
FT                   WRNTYAHLRASLGWEWVARRYAKLDLVRFLAGRPLALLEQMIEGGVNSPVSSSAGRLFD
FT                   AVAAAAGVCRERVQYEGQAAIEFEALIDRRTLHDEDDALAYPFRIGEASDAAYPLLIDA
FT                   KPMWLALLDDLMRATPAPVIAARFHKGFTIAIVQMVKRALGSRLHGSAPAVRTVALSGG
FT                   VMQNAALFEQLSERLAACGLVVLAHRQVPANDGGIALGQAAIAAGRALAHVEQRNTLCA
FT                   "
     atgcctaccc gcgtgcacac cgttcgcgat gacgagccgc tggtaagcaa gtggggcggc        60
     gaggcaattc gggtgcgcgg attggtgcag ggcgttggct ttcggcccgc cgtctggcgt       120
     ctcgcgcatg actgcggcgt gagcggcacc gtctgcaacg acggggaagg tgtactgatc       180
     cgcgcgtggg cggacaggcc ggtgctcgag cgcttcgtcg cgggcttgca tggccgctgt       240
     ccgccgcttg gacggatcga ctcggtggag cgacgcgcgg tcccggacgt ggcgccagcg       300
     cccggcgaat tcacgatcgt tgaaagcggc ggtggtcctg cgcataccgg cgtggtgccc       360
     gacgcggtga cgtgccgggc ctgtctcgat gagacgctcg atccatcggg gcgccgctac       420
     cgttatccgt tcaccaactg cacgcattgc gggccgcgcc tgtcgattgt cggtgcgatc       480
     ccctatgatc gttgcgctac gacaatggcc gccttccctt tgtgcggcgc gtgtcgccgg       540
     gaatatgacg atccggggga ccggcgcttt catgcacagg cggtagcctg tccggcgtgc       600
     gggccacgaa tatggatcga gcaggccgac ggctcgcggg aacgaggcga tccgctcgag       660
     gtcgcgtgtc gttatctgcg gctcggcggc atcgtcgcga tcaagggact gggcggtttt       720
     cagcttgcgt gcatggcgac ggcgcaggcg gcggtcacga aattgcgcgt gctgaaacac       780
     cgtgcacgca aaccgtttgc gttgctggcg cgagacgtga cgatggccga acgttattgc       840
     agcgtgagca atgcggacgc ggcgttgctg cggagtgccg cgggtccgat cgtcatcatg       900
     ccggcgatcg ggcggaccac ggcggccgat ctttccggcg tggcgccggg caccgcaacg       960
     ttaggcttca tgctgccgtc gacgccgttg catcatctga tcatgcgtgc tctcgatgcg      1020
     ccgatcgtgc tgaccagcgg taacgtcgcc gacgaaccgc aatgtacggc gaatgacgat      1080
     gctcggatcc ggctcgcggg catggccgat gtgtttctga tgcacgatcg cgagatcgcg      1140
     tcgcgcatcg acgattcggt ggcgagggtg ctgcacggcg tgccgcgcct gttgcgcagc      1200
     tcacgtggct atgcgccagc accgctgcgc atgccgcatg atttcgccgc tgcaccgccg      1260
     gtgctggcga tgggtgcgca acagaaaaac gcgttctgcc tgctgcgcga aggcgaggcg      1320
     ctggtttcgc atcacatcgg cgagctggaa aacggcgaga cttatcgcga ctacaaggcg      1380
     tcactcgcgc gatacgaaaa actgttcggg cacgacgcgc gcgtggtggc ggtcgatctg      1440
     catcccgagt atctgtcacg taagctcggg atcgacatcg cgcggcaacg gagtctgccg      1500
     cttgcggaga tccagcacca tcacgcgcat ttcgccgcat gtctcgcgga aaacgatatc      1560
     ggcctcgcgt cgaatatcct cggcgtcgtg ctcgatggcc acggtatggg cactgaccgt      1620
     cgcctgtggg gcggcgaatt tctgctgggg ggatacgtcg actgcacgcg cgtggccagc      1680
     ttgacgccgg tggcgttgcc cggcggcatg cgcgcagtcc ttgagccgtg gcgcaatacg      1740
     tatgcacatc tgcgcgccag cctggggtgg gaatgggtcg cgcggcgata cgcgaagctc      1800
     gacctcgtcc gctttcttgc cggcaggccg ctagcgctgc tcgagcagat gatcgaaggc      1860
     ggcgtgaaca gtccggtctc aagttcggct ggacgcctgt tcgacgcggt cgccgcggca      1920
     gccggcgtgt gccgcgagcg ggtgcagtac gaagggcagg ccgcaatcga attcgaagcg      1980
     ctgatcgacc ggcggacgct gcatgatgaa gatgacgcac tcgcttatcc gttccgcatt      2040
     ggtgaagcgt cggacgcggc atacccgctt ctgatcgacg cgaaaccgat gtggcttgcg      2100
     ctgctcgatg acctgatgcg cgcgacgccg gcaccggtga tagccgcgcg ctttcataaa      2160
     gggttcacga tcgcgatcgt gcagatggtc aagcgcgcgc tcgggtcgag actgcatgga      2220
     tcggcgcctg cggtgcgcac ggtcgcgctg tccggcggcg tcatgcaaaa cgcggcgctt      2280
     ttcgaacagc tttcggagcg gcttgccgca tgcggcctgg tggtgctggc tcatcgccag      2340
     gtgcccgcga atgacggcgg cattgcgctg gggcaggccg cgattgccgc agggcgtgcg      2400
     ctggcgcacg tagagcaaag gaacacgtta tgtgcctag                             2439
//

If you have problems or comments...

PBIL Back to PBIL home page