(data stored in SCRATCH zone)

EMBL: CP000272.PE510

CP000272.PE510       Location/Qualifiers
FT   CDS_pept        555781..556827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0538"
FT                   /product="Putative hydrogenase expression/formation protein
FT                   HypE"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36438"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK1"
FT                   /protein_id="ABE36438.1"
FT                   /translation="MNDRVNKLRDVTINLGHGGGGRAMRDLIEDVFVAAFDNPALAALE
FT                   DQAVFPLAELARHGDRLAFTTDSYVVDPLFFPGGDIGALAVSGTVNDLAMSGARPLFLS
FT                   CGMVIEEGLAVDTLRRVAASMQRVAIEAGVSIVTGDTKVVERGSADKLFINTAGIGIVP
FT                   AGVNISARRAQVGDAVIVNGFLGDHGVAILIARQQLALQADVASDCGPLGSLVATMLGA
FT                   CDDIHCMRDATRGGMATVLNEFAVSSGVAIHIRETAIPVRDEVRGACEILGLDPLYLAN
FT                   EGKLIALVPARCAQRLLAAMRRHPAGRDAAIIGEVVALPAGIVVLQTEFGGQRIVDMLV
FT                   GEQLPRIC"
     atgaatgaca gggtcaacaa actgagggac gtgacgatca atctcgggca cggcgggggt        60
     ggccgggcga tgcgcgatct gatcgaagac gtgttcgtcg ctgcattcga caatcccgcg       120
     ctcgcggcgc tggaggacca ggcggttttt ccgcttgccg aactcgcgcg ccacggcgac       180
     cggcttgcat tcactaccga tagttacgtg gtcgatccgc tgttctttcc gggcggcgac       240
     atcggcgcgc tggcggtatc gggcaccgtc aacgatcttg cgatgtcggg cgccaggccg       300
     cttttccttt catgtgggat ggtgatagaa gaggggcttg ctgtcgatac actgcgtcgc       360
     gtagcggcca gtatgcagcg ggtggcgatc gaggcgggcg tatccatcgt gaccggcgac       420
     accaaggtgg tcgagcgtgg cagtgcggac aagctgttca tcaacaccgc cgggatcggc       480
     atcgtacctg cgggagtgaa tatttccgcc cgccgcgccc aggtgggaga cgccgtgatt       540
     gtgaacggct ttcttggaga ccacggcgtg gcgatcctga ttgcaaggca acaactcgcc       600
     ttgcaggccg acgttgccag cgactgcggg ccgctgggct cgctggtggc gacgatgctc       660
     ggcgcgtgtg acgacattca ttgcatgcgg gacgcgacgc gcggcggcat ggcgactgta       720
     ttgaacgaat tcgccgtttc gtcgggcgtg gcgattcata tccgggagac cgcgataccg       780
     gtgcgggacg aagtcagagg cgcatgcgaa attctcgggc tcgatccgct ctatctggcc       840
     aacgagggca aactgattgc gctggtaccc gcgcgctgcg cgcagcggct acttgcagca       900
     atgcgccgcc atccggcggg aagagacgcg gctatcatcg gcgaggtggt ggcgctgccc       960
     gcagggatcg tggtcctgca aacggagttc ggcggccagc ggattgtcga catgctggtc      1020
     ggcgaacaac tgccacgaat ctgctag                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page