(data stored in SCRATCH zone)

EMBL: CP000272.PE516

CP000272.PE516       Location/Qualifiers
FT   CDS_pept        561745..562617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0544"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36444"
FT                   /db_xref="GOA:Q13HJ5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ5"
FT                   /protein_id="ABE36444.1"
FT                   /translation="MNPITLFLSVALVLAGAVAGQWLSIYLAPPLIIVGILIGLSVKVA
FT                   NVWEKFVILRLGKLQSVRGAGFFMIIPLLDHIVAIIDERIQTTAFNAEQALTKDTVPVN
FT                   VDAIIFWHVADAKKAALAITDYRQAIDRVSQTTLRELIGSSMLAMLLSDRIYADAHLRD
FT                   VIGSKTAEWGIAVGSVEIRDVAIPVALQDAMSRQAQAEREKQARVILGSAEAAIAANFV
FT                   EAARVYENQPGALQLRAMNIIYETTKERGATILMPTSMVDSLNPALALAIAGRDPATGA
FT                   AVSPLKTAA"
     atgaatccga ttacgttgtt tctgtcagtc gcattggtgc tggccggtgc tgtcgccggc        60
     caatggctca gcatctatct ggcgcctccg ttgatcatcg tcggtatcct gatcggactg       120
     tccgtgaagg tggccaatgt gtgggagaaa ttcgtgatcc tgcggcttgg caagctgcag       180
     agcgtcaggg gtgcaggctt tttcatgatc attccgctgc tcgatcacat cgtggcgatc       240
     atcgacgaac gcatccagac cacggctttc aacgcggagc aggcgctgac caaagacacg       300
     gtgccggtca acgtcgacgc aatcatcttc tggcatgttg cggatgcgaa aaaggcggcg       360
     ctcgccatca ccgattatcg ccaggcgatt gatcgagtgt ctcagaccac gttacgcgaa       420
     ttgatcggat catcgatgct ggctatgctg ctgtcggatc ggatctatgc ggatgcccat       480
     ctaagagacg tgattggcag caagacggcg gaatggggca ttgcggtcgg ttccgtggag       540
     attcgagacg tagcgattcc ggtcgcgctg caagacgcga tgtcccgtca agcgcaggct       600
     gagcgggaaa agcaggcgcg cgtcattctg ggttccgcag aagccgccat tgctgcgaat       660
     ttcgtcgagg cggctcgtgt ctatgagaac cagccaggtg cgcttcaact tcgcgctatg       720
     aacatcattt atgaaactac caaagagcgc ggtgcgacca tcctcatgcc gacgtcgatg       780
     gtggacagtc tgaatccggc gctggcgcta gcgatcgccg gccgcgatcc tgctaccggc       840
     gcggcggtga gcccgctcaa gacggcagcc tag                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page