(data stored in ACNUC7421 zone)

EMBL: CP000272.PE519

CP000272.PE519       Location/Qualifiers
FT   CDS_pept        566352..566681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36447"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ2"
FT                   /protein_id="ABE36447.1"
FT                   /translation="MSKKRTDAELARTQTTQAALVALASHIQTLVADQSLDSRCAAKLV
FT                   RRLKKEAATLEDSSAGTKASRKMLAMTLDALDTALFDQGAMLLVAANATLRADDVSDGA
FT                   TTQRT"
     atgagcaaaa aacgcactga cgcggaactc gccaggactc aaaccaccca ggcggcgctt        60
     gtcgcactgg ccagtcacat ccagaccctt gtagcggatc agtcgctgga cagtcgatgt       120
     gccgcgaagc tcgttagacg gctgaagaag gaagccgcga ctctggaaga cagcagcgct       180
     ggaaccaagg caagccgaaa aatgctggcg atgacgttgg acgcactcga tacggcgctg       240
     ttcgaccaag gtgcgatgct gctggtggcg gccaacgcga cgcttcgagc agatgacgtg       300
     tcagacgggg ccaccacgca aaggacctaa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page