(data stored in ACNUC7421 zone)

EMBL: CP000272.PE520

CP000272.PE520       Location/Qualifiers
FT   CDS_pept        complement(567652..568044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0549"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36448"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ1"
FT                   /protein_id="ABE36448.1"
FT                   /translation="MKSHIAPPLATLLILALTSGTLRAQGTPQPINAQHVDMVQLATGY
FT                   RASKIDGSPMFNRTQDKIGTIDDLITSPNNPIPYAILSVGGFLGMGTHLVAVPWNSLQI
FT                   VNRQMRLPDATKESLKALPEFRYAPD"
     atgaaaagcc atatcgcgcc gccgctggcg acgctgctta tcctggccct cacgagcggc        60
     acgctccggg ctcagggcac accacagccg atcaacgcac agcacgttga catggtacag       120
     ctggcgactg gatatcgggc ctcgaagatc gatggatctc ctatgtttaa ccgcacccag       180
     gacaagatcg ggacaatcga cgatctgatc accagcccca acaatccgat accctacgcg       240
     atcctgtcgg tgggcgggtt tctcggaatg ggaactcacc tggtcgcggt cccatggaat       300
     agcctgcaga tcgtcaaccg ccagatgcgt ttgccggacg caacgaaaga atcgctaaag       360
     gcattacccg aattcagata tgcgcctgat tag                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page