(data stored in ACNUC7421 zone)

EMBL: CP000272.PE521

CP000272.PE521       Location/Qualifiers
FT   CDS_pept        complement(568328..568627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36449"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ0"
FT                   /protein_id="ABE36449.1"
FT                   /translation="MDDGNGIWIFVDIDLTRVTSKSVGIQANLLESLLQQVDARAKERR
FT                   MTRYAFVTLALIDELKQHDNHRLAIQFMNVVAGASLLVAPGVERAIPRHHRGLS"
     atggacgatg gcaacgggat ctggatattt gtcgacatcg atctgacgcg tgttacctcc        60
     aaatccgtgg gcattcaagc caatctgctt gagagccttc ttcaacaagt cgatgcaagg       120
     gcgaaagagc gccgcatgac gcgctatgca ttcgtcacac ttgcgcttat tgatgaattg       180
     aagcaacacg ataaccatcg tcttgccatt cagttcatga acgtggtcgc gggcgcatcc       240
     cttctcgtgg cgcccggagt tgaacgtgcg attcctcggc accatcgtgg cctgtcgtaa       300
//

If you have problems or comments...

PBIL Back to PBIL home page