(data stored in ACNUC7421 zone)

EMBL: CP000272.PE525

CP000272.PE525       Location/Qualifiers
FT   CDS_pept        complement(572926..574215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0554"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /function="Natural resistance-associated macrophage
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36453"
FT                   /db_xref="GOA:Q13HI6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI6"
FT                   /protein_id="ABE36453.1"
FT                   /translation="MDTLTHDPVKQPARPKLLQVMGPGLITGASDDDPSGIATYSQIGA
FT                   QFGYGLAWTLLFSYPLMAAIQEISARIGRVTGSGIAGNLRQHYPRWLSTSVVGMLLVAN
FT                   IINLGADLGAMGSALKLLIAGPALLYVCGFGLLSVVLEIFTRYARYVSILKWLCLSLFS
FT                   YVICAFVVKVPWDQVGRAVLLPALSIKPDYLVAIVAVMGTTISPYLFFWQAEQELEDEK
FT                   ERPGAHPLIHAPWEAPAEFARIRVDTYLGMALSNVVAFFIVVTTATTLHAHGLTNIQTS
FT                   AQAAEGLRAVAGPFTFFVFAAGIIGTGLLTLPVLAGSGAYALGELFAWRVGLARLPSQA
FT                   KAFYGVIAAATAIGAGLNFTSVDPVKALYWSAVLNGVVAVPVMIVMMHLSMRTRIMSGL
FT                   TLPPALRILGWVATGVMAATVVAMGVTWFA"
     atggacacgc tcactcacga tccggtcaag cagccggctc ggccaaaact gctgcaggtg        60
     atggggcccg gcctcatcac cggtgcatcg gacgacgatc cgagcggtat cgcaacgtat       120
     tcccagatcg gcgcgcaatt cggctacggc ctcgcgtgga ctctcctgtt cagctacccg       180
     ctgatggccg cgattcagga gatcagtgcg cgcatcgggc gcgtgaccgg cagcggtatc       240
     gcgggcaatc tgcgtcagca ctatccgcgc tggctgtcga ccagcgtagt cgggatgctg       300
     ctcgtcgcga acatcatcaa tctgggggcg gacctcggcg caatgggctc ggcgctgaag       360
     ctgctgatcg ccggtcccgc actgctctac gtgtgcggtt tcgggctgct gtcggtggta       420
     ttggaaatat tcacccgcta tgcccgctac gtgtcgattc tcaaatggct atgcctgtcg       480
     ctgttcagct atgtaatctg cgcgtttgtc gttaaagtgc cgtgggatca ggttggccgc       540
     gccgtgctat tgcccgcgct gtccatcaaa ccggactacc tcgtggctat tgtcgccgtc       600
     atgggcacga cgatcagccc ttacctgttc ttctggcaag ccgaacagga actcgaggac       660
     gaaaaggaac ggcccggcgc gcatccattg atccacgcgc cgtgggaagc gcccgcggag       720
     ttcgcgcgga tccgcgtcga tacctacctc ggcatggcgc tctcgaatgt ggtcgcgttc       780
     ttcatcgtcg taacgacggc gacgaccctg catgcgcacg gcctcaccaa tattcagact       840
     tcggcgcagg ccgcggaagg gctgcgtgcc gtagcaggtc cgttcacgtt ctttgtattc       900
     gccgccggca tcatcggcac cggcttgttg acgctgcctg tgctggccgg ttctggcgca       960
     tatgcgctgg gcgagttgtt cgcgtggcgc gtgggcctcg cgcgcctgcc gtcgcaggct      1020
     aaagcgttct acggtgtgat cgccgccgca acggcaatcg gcgccggcct gaacttcacg      1080
     tcggtcgatc cggtcaaggc gctctattgg agcgccgtgc tcaacggtgt cgttgcggta      1140
     cccgtgatga tcgtcatgat gcatctctcg atgcgtaccc gcatcatgtc cggtctcacg      1200
     ctgccgccgg cactccgtat cctcggctgg gttgcgaccg gtgtgatggc ggcaacggtc      1260
     gtggcgatgg gagtcacctg gttcgcgtga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page