(data stored in ACNUC7421 zone)

EMBL: CP000272.PE532

CP000272.PE532       Location/Qualifiers
FT   CDS_pept        580743..581927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0561"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36460"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH9"
FT                   /protein_id="ABE36460.1"
FT                   /translation="MALYSKVLCRLLACVVAATAVTDSTVYADDMKTIDIGMISSRSGV
FT                   YQAFGIPAEDGVRLAVSEINRTGFEVGGQHYKLNLIIRDDRSTEVGATTIATEYVRDQN
FT                   IKFIFGGIGRLAPLIVQITGPEKAIFATASGAAASQFSGKPAGRYLISTLPPIESRARI
FT                   VAEAMRYYFPNAKSVQRLGPQTADNQAIFPLLPEPLRAKGFSNIPDPIYYQPDTTDFSG
FT                   ILTNLKQSRPDVIFLGQLDPARASAIIKQNDDIQATGGWFAWGLDCNANATAGTKTPYV
FT                   GFPTVGAMVDTPQTPQAREFVEKMKKMTGTLPPYLYAATYDYDFVFTLVEAMKKSNTVT
FT                   DTDRIIGALRGLTYNGLVGQITFDAENRAQYGLDACKITSAGVSEVRHFNMSRN"
     atggcgttat attcaaaagt actatgccgc ttgcttgctt gcgtcgtggc ggcaactgca        60
     gtgacagatt cgaccgtcta tgccgatgat atgaagacca tcgatatcgg tatgatttcc       120
     tcacggtctg gcgtctatca ggcgtttgga attccagcgg aagacggtgt tcgtctggct       180
     gtttcggaga ttaatcgaac agggtttgag gtgggggggc agcattacaa gctcaacctg       240
     attatccggg acgatcgcag tacggaagtg ggcgctacca cgatcgctac ggaatacgtg       300
     cgcgatcaga acatcaaatt catctttggt gggattggaa gactcgcgcc tctgatcgtg       360
     cagatcacag gaccggaaaa ggccattttt gcaacagcga gcggggcagc agcttcccag       420
     ttttcaggaa agccggcagg caggtatctt atctcgacct tacctccaat cgaatccagg       480
     gcccggatag ttgctgaagc gatgcgctat tactttccga acgcaaaaag cgttcagcgg       540
     ctaggtccac agacggcgga taatcaggcg atatttccgc tattgcctga accacttcgg       600
     gcgaagggat tttcaaatat tccggacccc atatactatc agcccgatac gactgatttc       660
     agcggaatcc tgaccaatct gaagcaatcc agaccagatg tcatcttcct ggggcaactg       720
     gatccggcac gggcctcggc aatcatcaaa cagaatgacg atatccaggc gacaggtggc       780
     tggttcgcct gggggctcga ttgcaatgcg aatgccactg ccgggacgaa aacaccatac       840
     gtcggattcc caactgtagg cgcgatggtc gataccccgc agacaccaca agccagggaa       900
     tttgtcgaaa aaatgaagaa aatgactggg acattgccgc catatcttta tgcagcaacc       960
     tatgattacg attttgtatt tacccttgta gaagccatga aaaagtcgaa taccgtcact      1020
     gataccgaca ggataatagg agcgctccgg ggattgactt acaacggact ggttggccag      1080
     attacttttg atgcagaaaa tcgggctcag tatggtttgg atgcgtgcaa gatcaccagt      1140
     gctggcgtaa gtgaagtgcg gcattttaat atgtccagaa actag                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page