(data stored in ACNUC7421 zone)

EMBL: CP000272.PE533

CP000272.PE533       Location/Qualifiers
FT   CDS_pept        581940..582812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0562"
FT                   /product="neutral amino acid ABC transporter membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36461"
FT                   /db_xref="GOA:Q13HH8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH8"
FT                   /protein_id="ABE36461.1"
FT                   /translation="MSYIGQQLVNALTLAGLYSLVALGVSLTFGLTRLVNFAHGEILML
FT                   GGYMTFSCMSLGVPFSLALVLAFLGTFLVGLILERSLFRFTLSKPINGFIISLGLIIVI
FT                   QNAVIMFYGSEPQMISSPLKTVWSLDGVRIPSARLVVFIVAAALIAGYLAFTKYSRWGR
FT                   ALRACNEDREGAALLGIPTNRIIMWTFAAGSGVAGLGGGLLAAMLPISAGEGGLVIVKA
FT                   FAIALVGGLGSPNGVVAGSLIVALLETFLPGAVMPVEWAPAVPFILIVIVLLVRPQGLF
FT                   KGGEGSPVS"
     atgagctaca ttggacaaca actcgttaat gcgctgacac tcgcaggcct gtattcgctg        60
     gttgcgctgg gtgtgtcgct gacgttcgga cttacccgcc tcgtgaattt cgcgcatggc       120
     gaaattctga tgctgggagg atacatgacc ttctcctgca tgtcgctggg tgttccgttc       180
     agcctcgcac tcgtccttgc ctttctcgga acgttcctcg tcggtctgat actggaaagg       240
     tcgttattca ggtttacgtt atctaaacct atcaatggat tcataatttc cctggggctg       300
     atcatcgtaa tccagaatgc ggtgatcatg ttttacgggt ccgagccgca gatgatttct       360
     tcgccgttga aaacggtatg gtcgcttgat ggtgtccgga ttccttccgc acgactggtg       420
     gtctttattg tcgcggccgc cctgattgcg ggctatctcg ctttcacgaa atactcccga       480
     tgggggcgcg cgctgcgagc atgcaacgaa gatcgcgaag gcgccgcttt gctcggcatt       540
     cctaccaacc gtatcattat gtggaccttc gctgcgggaa gcggcgtagc agggttggga       600
     ggcggtttgc ttgcagcgat gcttcccatc agtgcggggg aagggggact ggttattgtg       660
     aaggcgttcg cgattgcgct ggtgggcggc ttgggcagtc caaatggcgt agtggcgggt       720
     tccctgatcg tcgcgcttct tgaaacattc ttgcctggtg cagtgatgcc ggtcgaatgg       780
     gctcctgccg taccgttcat attgattgta atcgtgctgc tcgtacgtcc tcagggattg       840
     tttaagggcg gcgaaggatc ccccgtatca tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page