(data stored in ACNUC7421 zone)

EMBL: CP000272.PE534

CP000272.PE534       Location/Qualifiers
FT   CDS_pept        582809..583807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0563"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36462"
FT                   /db_xref="GOA:Q13HH7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH7"
FT                   /protein_id="ABE36462.1"
FT                   /translation="MKHMNIWTQRTFCIAIVLIVVVGFALPWTGVSNSALFLTTMIMIY
FT                   AIVAQGTNFLYSTAGILSVAQGALWGVGAYVAAIGLQRYNIGFGFALLLSIPAGAIVAI
FT                   LTGYPAKRVQGHYFAIVTFAFAEIFVIVGNNAVGWTGGNQGLIVAGRPLAGLSFLSDLQ
FT                   ANYLVAFLCFLGSLIAAVLLQRSGFGTRLAAAKTNSALAVSLGMNVVRDRLIAFAVSGA
FT                   AAGIGGVLYAYLTRYAQPGSFDVWAGITSLLIVMLGGRGYLLGPFIGSAVTLYVPAALD
FT                   LNPNLNQILYGLLLVGVMLVLPQGLLGVTAQLLGASRRVTTRVAGQRSEPR"
     atgaaacata tgaatatctg gacgcaacgg acattctgca tagcaatcgt cctgattgtc        60
     gtggtggggt ttgcgcttcc gtggacgggg gtcagtaatt ccgcgctctt cctgacgacc       120
     atgataatga tttatgcgat cgtcgctcag ggtaccaatt ttctttatag caccgcaggt       180
     attttgtcgg tcgcgcaggg agccctttgg ggcgtcggtg cctatgtggc tgcaattgga       240
     ctgcaacggt acaacattgg attcggattt gcccttctac tttccatccc tgcaggagcg       300
     atagtcgcga ttctcaccgg atatccagcc aagcgtgttc aggggcacta ctttgctatc       360
     gtcacgttcg cttttgcaga aatcttcgtt attgtcggaa acaatgccgt tgggtggacg       420
     gggggcaatc agggccttat cgtggctggg cgtccgttag ccgggctatc gtttctttcc       480
     gatctccagg cgaattatct tgttgcattc ctgtgttttc tgggaagttt gattgcggcc       540
     gtattgctcc agcgctcagg gttcgggact cgtctggccg cagcgaagac gaactcggcg       600
     ctggccgtct cgcttgggat gaatgtcgtc cgtgaccgtc tgattgcatt tgcagtcagt       660
     ggtgcggcgg caggaatagg tggcgttcta tacgcctatc tgaccagata tgcccaaccc       720
     ggcagctttg atgtctgggc agggataacg tcactgctta tcgtcatgct cggtggccgg       780
     ggctatcttc ttggaccgtt catcgggtcc gctgtcacgc tttatgtccc tgcggcactg       840
     gatctgaatc caaatctgaa tcagattttg tatggattat tactggtcgg tgtcatgctg       900
     gttttgccgc aggggctttt aggggtaacc gctcagctgc taggcgcttc gcgccgggtg       960
     actacccggg ttgctggtca aaggagcgaa ccaagatga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page