(data stored in ACNUC7421 zone)

EMBL: CP000272.PE536

CP000272.PE536       Location/Qualifiers
FT   CDS_pept        584528..585232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0565"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36464"
FT                   /db_xref="GOA:Q13HH5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH5"
FT                   /protein_id="ABE36464.1"
FT                   /translation="MLDLGNVNVAYGRRPVIHNMHLKVGEGEAVSVLGPNGAGKTTLLR
FT                   AISGMIPVKTGSIRLNSQELANASPNAVARHGVMHVAEGRRLFGNMTCRENLMLGGYMR
FT                   SGPAVNQDFRRLLDVFPEIEPKLDVRAGALSGGQQQMLAIARGLMSRPKILMLDEPTIG
FT                   LSPLVVQRLKTVLTSSAREFFGSLLLVEQDLSLALAVTSRVYVIRNGRIVHEGAVQNIQ
FT                   RENLVEQYFGVA"
     atgcttgatc ttggaaatgt gaatgtggct tatggacggc gacctgttat tcataatatg        60
     catttgaagg tcggcgaagg agaagctgtc tcggtgctcg gaccgaatgg ggcgggcaag       120
     acgacgctgc tgcgcgcaat atccggcatg ataccggtca agacaggtag cattcgcctg       180
     aacagtcagg aactcgcaaa tgcctcgccg aacgccgttg cgaggcatgg ggtaatgcat       240
     gttgctgagg ggaggcgcct ttttggcaac atgacatgtc gggaaaatct tatgctgggg       300
     ggctacatgc gtagtgggcc cgccgtgaat caggatttca ggaggctgtt ggacgttttc       360
     cccgaaattg aaccgaagct cgatgttcgg gcaggtgcgc tttcaggagg ccagcagcag       420
     atgctcgcaa ttgcacgcgg attgatgagc agaccaaaga tcctgatgct tgacgagccg       480
     acgatcggac tgagtccgct tgtcgtgcaa agacttaaaa cggttttaac cagctccgct       540
     cgtgagtttt tcggatctct actcctggtt gagcaggatc tctccctcgc gctcgctgta       600
     acatcacgcg tctacgtaat ccggaatggc aggatcgtcc atgagggcgc tgtccagaat       660
     atccagcgag agaatctggt cgagcagtat ttcggtgtcg cttag                       705
//

If you have problems or comments...

PBIL Back to PBIL home page