(data stored in ACNUC7421 zone)

EMBL: CP000272.PE545

CP000272.PE545       Location/Qualifiers
FT   CDS_pept        594489..595337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0575"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36473"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HG6"
FT                   /protein_id="ABE36473.1"
FT                   /translation="MENYSSWIGRNETRQDVATLQPALALGATLDRATIFLNGRSELPP
FT                   LSHWLYFLSTAPMSRLGTDGHPRRGDFLPPISLPRRMWAGSRIDFLVPIVIGAPIERTS
FT                   TIVRVNEKRGRSGTLCFVTLLHEVKVDSILAVREEQDIVYREASPLGDPLTKGVAVTES
FT                   AALASPDWTRTVMPDPVLLFRYSALTFNGHRIHYDRDYATKEEGYPGLVVHGPLQATLL
FT                   LDLISRSRPAATVRKFSFRAKNPLFDGKPLELCASLSGHMVKLWTVQSAHVGIEADAEL
FT                   E"
     gtggaaaact actcaagctg gattggaaga aatgaaaccc gccaggacgt cgctacgctt        60
     cagccggctt tggcgctcgg ggctaccctg gacagggcga caatcttcct gaatggccgg       120
     tccgaactgc cgccactgtc gcattggctg tattttcttt cgacagcgcc tatgtcccgg       180
     ttgggcaccg acgggcatcc caggcgggga gacttccttc caccgatttc gttgcctcgc       240
     cgaatgtggg ctggaagccg catcgatttc ctggtcccga tcgttatcgg ggcacccatc       300
     gagcgcacca gtacaatcgt ccgtgtcaac gagaagagag ggcgctccgg cacattgtgt       360
     tttgtgactc ttttacatga agtgaaagtt gactccatac tcgcggtacg cgaagagcag       420
     gacatcgtct accgggaagc atcgccgttg ggagatccac tgacgaaggg cgtcgcggtt       480
     acggaatctg cagcgcttgc atcacccgac tggacacgta cggtcatgcc ggatcctgtc       540
     ctgctgttcc gctattcggc actgaccttc aatggacatc gaattcacta tgatcgggac       600
     tatgcgacga aggaggaagg ctatcccggc ctggtcgtgc atgggccgct ccaggctacc       660
     cttttgctcg atctcatcag tcgtagcagg cccgctgcta ccgtcaggaa attcagcttt       720
     cgagcgaaaa acccactgtt tgacggcaaa ccgttggagt tgtgcgcctc tctttccggg       780
     catatggtaa agctttggac agtccagtca gcccatgtag gcatcgaggc cgacgccgaa       840
     ttggaatag                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page