(data stored in SCRATCH zone)

EMBL: CP000272.PE552

CP000272.PE552       Location/Qualifiers
FT   CDS_pept        complement(601264..601677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0582"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36480"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF9"
FT                   /protein_id="ABE36480.1"
FT                   /translation="MERKLPSLTPETAPFWQGGSKGVLNIYHCARCERFFHPPAPICPR
FT                   CLSAEVGARPVSGRGHVFSFTVNQQRWTPDLAVPYVVAIVELSEQPGLRFVSNVVGSPV
FT                   DEIHIGMPVRVTFEQIEDVWLPLFELDDERSHA"
     atggagagaa aattaccgtc cctcactccc gagaccgcgc cgttctggca aggcggttca        60
     aaaggggtgc tgaatattta ccactgcgcc cggtgcgaac gcttctttca tccgcccgcg       120
     cccatctgcc cgcgttgcct gtcggccgag gtcggggcgc ggccggtgtc aggacgcggc       180
     cacgtattca gcttcacggt caatcaacag cggtggacgc cggaccttgc agtcccttat       240
     gtggtggcga tcgtcgaact gtcagaacag cccgggctgc gtttcgtcag caatgtcgtc       300
     ggttcccccg tagacgagat ccacatcggc atgccggtgc gcgtcacgtt cgagcagatc       360
     gaggatgtct ggctcccgct cttcgagctc gacgacgagc ggagtcacgc ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page