(data stored in SCRATCH zone)

EMBL: CP000272.PE556

CP000272.PE556       Location/Qualifiers
FT   CDS_pept        604144..605550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0586"
FT                   /product="Rieske-type ring hydroxylating dioxygenase alpha
FT                   subunit"
FT                   /note="Citation: J. Bacteriol. 181:2675-2682(1999)."
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36484"
FT                   /db_xref="GOA:Q13HF5"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF5"
FT                   /protein_id="ABE36484.1"
FT                   /translation="MLTKSGPTLADGTKVADLVNLETREVQMRTLSDPELYELEMERIF
FT                   GKTWLLLGHESEIPAQGDFMVRDMGSDSVLVTRDKAGEIHVLLNVCSHRGMRVSTVDAG
FT                   NTQIHTCIYHGWAFTTNGSFLGAPVEKECMHGKIRSKAELGLKKARVTLYGGLIFATWN
FT                   IDGPSFEDFLGDAKWYYDMLFQRSDKGLEVLGPPQRFVVRANWKAAGEQSAADGYHTLT
FT                   LHRWLGEVGNYSHVKDKDSGANDLTQQMYGVEISSPHGHALRCQDLARKIRRLTGKEPA
FT                   DLTPEERFRVLPPPGMTADMVPQLLRHLGKEQIDVMASMPPQVGGIFPNVLFAFLYLPQ
FT                   PDGSSLGAIALHTYVPRGPDKLEFTNWVFVEKDTPADVREKMRKQSTQLLGTTGMVEQD
FT                   DSDTWPHMTLAAKGAMGRKMTLKYQAAYETGAPEGWPGPGIVNEGFTKDDTQWHWWQYW
FT                   LELMTADTDA"
     atgttgacta agtccgggcc gacactggcc gacggaacca aggtcgcgga tctcgtgaat        60
     ctcgaaacgc gcgaagtgca gatgcgtaca ttatcggatc ccgaacttta cgagctggag       120
     atggagcgca tcttcggcaa gacctggctg ctgctcgggc acgagagcga gattcctgcc       180
     cagggcgact tcatggtgcg cgacatgggc tccgattcgg ttctcgtcac gcgcgacaag       240
     gcgggtgaga ttcatgtgct gctgaacgtc tgctcgcacc gggggatgcg cgtgtcgacc       300
     gtggatgcgg gcaacacgca gattcacacc tgcatctacc acggctgggc gttcacgacc       360
     aatgggtcgt tcctcggcgc gcccgtggaa aaggagtgca tgcacggcaa gatccgctcg       420
     aaggcggaac taggcttgaa aaaggcgcgc gtgacgctct atggcgggct catcttcgcc       480
     acctggaata tcgatggtcc ctcgttcgaa gacttccttg gcgacgcgaa gtggtattac       540
     gacatgctct tccagcgtag cgacaagggc ctcgaagtgc tcgggccgcc gcaacggttc       600
     gtcgtgcgcg cgaactggaa ggccgcgggc gagcagtccg cggcggatgg ctaccatacg       660
     ctgacgctgc accgctggct gggcgaagtc ggcaactact cgcacgtcaa ggacaaggat       720
     tcgggcgcga acgacctgac gcagcagatg tacggtgtcg aaatcagctc gccgcacggg       780
     cacgcgctgc gttgccagga cctcgcgcgc aagatccggc gcctgaccgg caaggagccc       840
     gccgatctga cgcccgaaga gcggttcagg gtgctgccgc cgcccggcat gacggccgac       900
     atggtgccgc agttgctccg ccatctgggc aaggagcaaa tcgacgtgat ggcgtcgatg       960
     cccccccagg tcggcggcat ctttccaaac gtcctgttcg cgttcctcta tctgccgcag      1020
     cccgacggct cgtcgctcgg cgcaatcgcg ctgcatacct acgtgccgcg cggccccgac      1080
     aagctggaat tcacgaactg ggtcttcgtc gagaaggaca cgcctgccga cgtgcgcgag      1140
     aagatgcgca agcagtcgac gcagttgctg ggcacgaccg gcatggtcga gcaggacgac      1200
     tcggacacgt ggccgcatat gaccctcgcc gcaaaaggcg cgatgggccg gaagatgacg      1260
     ttgaagtacc aggctgctta cgagaccggt gcgcccgagg gttggccggg gccgggcatc      1320
     gtcaacgaag gattcacgaa ggacgacacg cagtggcatt ggtggcaata ctggctggaa      1380
     ctgatgaccg ccgacaccga cgcctga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page