(data stored in ACNUC7421 zone)

EMBL: CP000272.PE557

CP000272.PE557       Location/Qualifiers
FT   CDS_pept        605583..606143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0587"
FT                   /product="Rieske-type ring hydroxylating dioxygenase beta
FT                   subunit"
FT                   /note="Citation: J. Bacteriol. 181:2675-2682(1999)."
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36485"
FT                   /db_xref="GOA:Q13HF4"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF4"
FT                   /protein_id="ABE36485.1"
FT                   /translation="MSAVNAGIESADVGARVRIGSPVYNGVLEFLYEEAAMLDDLRLQD
FT                   WVATLAEDLIYTAPTRQTRPLAKLEQSVVRTMQHYDDDYRSIRGRVMRLTETKSAWAED
FT                   PPSRTRRLVTNVRVSEAGRPGEYEVRSNLLVTRSRFNFDAFDLVSAERRDLLRAHGESF
FT                   LLARREILLDQVVLGTPNLAIFL"
     atgagtgcag tgaacgccgg gattgaatcg gccgacgtgg gagcacgcgt gcggatcggc        60
     tcgccggtct acaacggggt gctggagttt ctgtacgaag aggccgcgat gctggacgat       120
     ctccggctgc aggactgggt cgcgacgctt gcggaggacc tgatctatac cgcaccgacg       180
     cggcagacac gcccgttggc aaagctcgag caaagcgtgg tccgtacgat gcagcattac       240
     gacgacgact accgctcgat ccggggacgc gtgatgcgtc tcaccgagac gaagagcgca       300
     tgggcggagg atccgccgtc gcgcacgcgg cgcctcgtga cgaacgtccg ggtgtccgaa       360
     gccggacggc ccggcgagta cgaggtgcgc agcaatctgc tcgtgacgcg cagccgcttc       420
     aacttcgatg cgttcgatct ggtcagcgcg gagcggcgcg acctgctgcg cgcgcacggc       480
     gaatcgtttc tgctcgcacg ccgcgagatc ctgctcgatc aggtcgtgct cggtacaccg       540
     aatctggcga tcttcctctg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page