(data stored in ACNUC7421 zone)

EMBL: CP000272.PE57

CP000272.PE57        Location/Qualifiers
FT   CDS_pept        65505..66554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0058"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35985"
FT                   /db_xref="GOA:Q13IV4"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR014336"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IV4"
FT                   /protein_id="ABE35985.1"
FT                   /translation="MRASPIQPTVDFNADGEQHGFLKLPHSHDTSAWGAEMIPVTVLRN
FT                   GEGPTALLTGGNHGDEYEGPIALAKLAGSLKAQDVRGRVIIVPFMNYPAFRAGSRTSPI
FT                   DRGNLNRSFPGKPDGTVTEKIADYFQRYLLPLADYVLDLHAGGRTLDFVPFAAIHLLPD
FT                   AGQQARCEAAMRAFGAPYSMRMLELDSVGLYDTAVEEAGKVFVSTELGGGGTATVQSVA
FT                   VAERGVRGFLRHAGILGQAAAAHEAGRESGRGAPRTTTLLDMPDGTCFTTSEHDGLLEL
FT                   CKDLGEMVESGEVIARIYDASRSGVAPVEYRARRGGMLAARHFPGLVRIGDTVAVVAEV
FT                   VERGIPVTL"
     atgcgcgcat cacctattca gccgacggtc gatttcaacg ccgacggcga acaacacggc        60
     tttctgaagc tgccacattc tcacgacacc tccgcgtggg gcgcggagat gattccggtc       120
     accgtgctgc gcaacggcga aggacccacg gcgcttctta ccggcggcaa tcacggcgac       180
     gaatatgaag gcccgattgc gttggcgaag ctggccgggt cgttgaaggc gcaagacgtg       240
     agagggcgcg tgatcatcgt gccgttcatg aattaccccg cgttccgcgc gggcagccgc       300
     acctcgccga tcgatcgcgg caatctgaac cgcagctttc ccggcaagcc ggacggcacg       360
     gtcaccgaga aaatcgccga ttattttcag cgctatctgc tgccgcttgc cgattacgtg       420
     ctcgatctgc acgccggcgg ccgcaccctc gacttcgtgc cgttcgccgc gattcacctg       480
     ttgccggacg ccggccagca ggcccgctgc gaagcggcga tgcgcgcctt cggcgcgccg       540
     tattcgatgc ggatgctcga actcgatagc gtgggactgt acgacacggc ggtcgaggaa       600
     gcgggcaagg tgttcgtgtc gacggaactc ggcggcggcg gcacggcgac ggtgcaaagc       660
     gtggcggtgg cggagcgcgg cgtgcgcggt ttcctgcggc atgcgggcat cctcggccag       720
     gccgccgctg cgcacgaggc cggtcgtgaa agcgggcgcg gcgcgccgcg caccacgacg       780
     ctgctcgaca tgcccgacgg cacctgcttc acgaccagcg agcacgatgg tctgctggag       840
     ttgtgcaagg acctcggcga aatggtcgag agcggcgaag ttatcgcgcg aatttacgac       900
     gcttcgcgca gcggcgtcgc gcccgtcgaa tatcgcgcgc gccgcggcgg catgctcgcg       960
     gcgcggcatt tcccgggcct cgtgcggatc ggcgatacgg tggcggtggt ggccgaggtc      1020
     gtcgaacgcg gcataccggt gaccctctga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page