(data stored in ACNUC7421 zone)

EMBL: CP000272.PE576

CP000272.PE576       Location/Qualifiers
FT   CDS_pept        complement(624933..626246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0606"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Citation: J. Bacteriol. 186:3631-3639(2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36504"
FT                   /db_xref="GOA:Q13HD5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HD5"
FT                   /protein_id="ABE36504.1"
FT                   /translation="MKLEDLILVSVDDHAIEPPNAFAHHMPARYKGREPKVVQRGGRDV
FT                   WEFEAKATGYMGLNSVVGRPKEEYGMEPLSYEHMRRGTWDIKARVDDMNANGVLGSLCF
FT                   PTFPGFAGQRFQVHEDRDISLAAIQAYNDWHLHDWCNAAPGRFIPLMLTPWWDMQAAAA
FT                   EVERLAKQGVHALTLSDNPTVHGYPSIHNDYWDPLWKACADNDVVICCHIGTGVKAAHA
FT                   SDESPIDAWITSMPIAISNSAADWIWAPMWKKFPRLRMALSEGGIGWIPYLLERADFTH
FT                   RHHHAWTMSNFGGKMPSDIFNEHFITCFIEDRFGLKNLDSINLDKVTWECDYPHSDCTW
FT                   PNSADVFWEQASAQNISDDVINRITHLNAMREFSYDPFAILGRENCTVGALRAQAKHVS
FT                   IEPALGLGGAAPVRDPNKPVTSGDINRMFAAADAQTAL"
     atgaaactgg aagacctcat tctcgtcagc gtggacgacc atgcgatcga gccgcccaac        60
     gcattcgccc atcacatgcc ggccagatac aaaggccgcg aaccaaaggt cgtccaacgc       120
     ggcggccgcg acgtctggga attcgaagcc aaggcgacgg gttacatggg gctcaattcg       180
     gtagttgggc gtccgaagga agagtacggc atggagccgc tcagctacga acacatgcgt       240
     cgtggcacgt gggacatcaa ggcgcgcgtc gatgacatga acgcgaacgg cgtgctcggc       300
     tcgctctgct ttccgacttt ccccggcttc gcgggccagc gttttcaggt gcacgaggac       360
     cgcgatattt cgcttgcggc gatccaggcc tacaacgact ggcatctgca tgactggtgc       420
     aatgcagcac ccggccgctt cattccgctg atgctcacgc cgtggtggga catgcaggcc       480
     gccgcggccg aagtcgagcg gctggccaaa cagggtgtgc atgcgttgac gctctcggac       540
     aacccgactg ttcacggcta tccgtcgatc cacaacgact attgggaccc gctgtggaag       600
     gcttgcgcgg acaacgacgt cgtgatctgc tgccatatcg gcaccggtgt gaaagcggcc       660
     catgcatccg acgaatcgcc gatcgacgcc tggatcacgt cgatgccgat cgcgatttcg       720
     aactccgcgg cggactggat ctgggcgccg atgtggaaga aatttcccag gctgcgcatg       780
     gcgctgtccg aaggcggcat cggatggatt ccgtacctgc tggagcgcgc ggacttcacg       840
     caccgtcacc atcacgcatg gacgatgtcg aacttcggcg gcaagatgcc gagcgacatt       900
     ttcaacgagc acttcatcac ctgcttcatc gaggacaggt tcggcctgaa gaatctcgat       960
     tcgatcaacc tggacaaggt cacatgggag tgcgattacc cccattcgga ctgcacatgg      1020
     ccgaattcgg cggatgtatt ctgggaacag gcatcggcgc agaacatctc cgacgacgtc      1080
     atcaaccgca tcacgcacct gaacgcgatg cgcgagttct cctatgatcc gttcgcgatt      1140
     ctcggccgtg aaaactgcac cgtcggcgcg ctgcgcgccc aggcgaagca tgtcagcata      1200
     gaaccggcat tgggcctggg tggagcggcg ccggtgcgcg acccgaacaa gccggtaacc      1260
     tcgggggaca tcaaccgcat gttcgccgcc gccgacgcgc agaccgcact gtag            1314
//

If you have problems or comments...

PBIL Back to PBIL home page