(data stored in ACNUC7421 zone)

EMBL: CP000272.PE593

CP000272.PE593       Location/Qualifiers
FT   CDS_pept        647160..648236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0623"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36521"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB8"
FT                   /protein_id="ABE36521.1"
FT                   /translation="MNTALDSGAPAPAGNADAQGPGDATPRKAGRRDWTPVNYDLRDAW
FT                   FPVSHSRDVTQRPIRRIIHSQPYYLWRDDGKPVASEFRADTPQSARARASAFTGGSGFY
FT                   PVVERYGYVWAWYGNPDCADVSLLPHIPFLPLDDSLPRYTQRTVRFDAASALSVENLLD
FT                   LTHADFLHAGTIGDGISQSDIVEVEWTSETVTRTRIVTQKSVAPIMRWVGGVRARYQDF
FT                   RAVLHVHLRSNVCISYPRFRPGYDVPNLQPFLPVGRHRSRCDVTFNTTAAPVPLRYVMP
FT                   RIAFVIQPQDNSVVRPQNERYFDPDERRDLHSRFDTPGTRYRFQMELLAQRQQRGDFSY
FT                   GPDADPGRDISGLLGMND"
     atgaacacag cgctcgacag cggcgccccg gcccccgccg ggaatgccga cgcacaggga        60
     cccggcgacg ccacgccgcg caaggccggg cgacgcgact ggacgccggt caactacgat       120
     ctgcgcgatg cgtggtttcc ggtatcgcac agccgcgacg tgacgcagcg gccgatccgc       180
     cgaatcatcc attcgcagcc gtattacctg tggcgcgacg acggcaagcc ggtcgcatcg       240
     gagttccgcg cggacacgcc gcagtcggcg cgcgcccgcg cgagcgcgtt caccggcgga       300
     tcggggtttt atccggtggt tgaacgctac ggctacgtct gggcgtggta cggcaatccc       360
     gattgcgcgg atgtctcgct tcttccgcac attccgtttc tgccgctcga cgacagcctg       420
     cctcgctata cgcagcgcac ggtgcgcttc gacgcggcgt cggcgctctc ggtcgagaac       480
     ctgctcgatc tcacgcacgc cgattttctg catgcaggca caatcggcga cgggatatcc       540
     caatccgata tcgtcgaggt ggaatggact tcggagacgg tgacgcgcac gcgcatcgtc       600
     acgcagaagt cggttgcgcc gatcatgcgc tgggtcggcg gggtacgcgc gaggtatcag       660
     gactttcgcg ccgtgctgca cgtgcacctg cgcagcaacg tttgcatttc gtatccgcgt       720
     ttccggcccg gctacgacgt gccgaacctg cagccgttcc tgcctgtggg ccggcatcgc       780
     tcgcgctgcg acgtcacgtt caacacgacg gcggcacccg tgccgctgcg ctacgtgatg       840
     ccgcgcatcg cgttcgtgat ccagcctcag gacaattcgg tcgtgcggcc ccagaacgag       900
     cgctatttcg atccggacga gcgtcgggac ctgcactcac gtttcgacac gccgggcacg       960
     cgttaccggt tccagatgga actgctggcg cagcgccagc agcggggcga cttctcatac      1020
     ggacccgatg ccgatccggg cagggacatc agcggactgc tcggcatgaa cgactga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page