(data stored in ACNUC7421 zone)

EMBL: CP000272.PE597

CP000272.PE597       Location/Qualifiers
FT   CDS_pept        complement(650923..651306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0627"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36525"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB4"
FT                   /protein_id="ABE36525.1"
FT                   /translation="MSIFTHFTLGTRDLDRAKAFYDRVLEPLNLKSLFSIEGKVCGWGK
FT                   EAPQLMVLYPRNGEPATAANGLTVGLAAPDREAVREFHRRALELGAVCEGPPGPRPFAP
FT                   NAYAAYIRDLDGHKIVASCRTPE"
     atgagtatct tcacgcattt cacgttgggc acacgcgatc tcgatcgcgc gaaggcgttc        60
     tacgaccggg ttctcgaacc gctgaacctc aaatcgctat tctcgataga agggaaagtc       120
     tgcggctggg gcaaggaggc cccgcaactg atggtgctgt acccgcgcaa tggagagccg       180
     gccacggcgg ccaacgggct gaccgtgggt ctcgccgcgc cggaccggga agcggtgcgg       240
     gaatttcatc gtcgcgcgct cgaactcggc gccgtctgcg aagggccgcc gggaccgcgc       300
     ccgtttgcgc ccaacgcgta tgccgcctac atccgcgatc tggacgggca caaaatcgtc       360
     gcgtcgtgca ggacgccgga gtga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page