(data stored in SCRATCH zone)

EMBL: CP000272.PE599

CP000272.PE599       Location/Qualifiers
FT   CDS_pept        complement(652402..652749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36527"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB2"
FT                   /protein_id="ABE36527.1"
FT                   /translation="MADTGHIEAFLLAQTDHWNAGDKQAFLDDYRRAAPDGLTIEYVGR
FT                   PPQDGWAVLDHMWRQQRDRIRVEPVAKIVNGNEAACYVRNVIIGTGSAIETIELYRFDA
FT                   GRLHVRYFIRQ"
     atggcggata ccggacacat cgaagcgttc ctgcttgcac agaccgacca ctggaacgca        60
     ggcgacaaac aggcatttct ggacgactac cggcgcgccg cgcccgacgg cctcacgatc       120
     gaatacgtcg gccgtccgcc tcaggacggc tgggccgtgc tcgaccacat gtggcgccag       180
     caacgcgaca ggattcgcgt cgaacccgtc gcgaagatcg tgaacggaaa cgaagcggcc       240
     tgctacgtcc gcaacgtgat catcggcacc gggagtgcga tcgaaaccat cgaactttat       300
     cgcttcgatg cgggccggct gcacgtgcgc tacttcatca ggcaatag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page