(data stored in ACNUC7421 zone)

EMBL: CP000272.PE600

CP000272.PE600       Location/Qualifiers
FT   CDS_pept        complement(652804..653835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36528"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB1"
FT                   /protein_id="ABE36528.1"
FT                   /translation="MKSFKTVPQRGDFRYQTLVAPHKVSGRAMHDLRGFYGLQLTKGMP
FT                   FGCVRDEDGEIYAFVRAVNEPGSTPNPTRFIYLSTRVDGQHLRIDKSRIEPRATTLFPR
FT                   RWLEGDTACWSSLEGEPGAGWQLSASGERLSWTEEGLFELGGPLLGQGMQWYLPGVDWG
FT                   TFYVSQIYDIAGICDGRRVKGLMCFDQAYMAEGGAIHFSKDLVVNHQMHVIWWSFATVY
FT                   KDGSWDVGSFMVGHDHLGYAIFQNDKGEIRTTTDIDGRVQHKDGSYFVESARIVLDGEE
FT                   EWEFLPCPKGEMIDFVGGFPITAQQEGRWRRVGDTREADRWVGWGESDRRNGTARNVRG
FT                   IQP"
     atgaaatcct tcaaaaccgt tccgcagcgc ggcgacttcc gctaccagac cctcgtcgcg        60
     ccccacaagg tcagcggccg cgcaatgcac gacctgcgcg gcttttacgg cctgcaactc       120
     accaagggca tgccgttcgg ctgcgtgcgc gacgaggacg gcgagatcta cgcgttcgtg       180
     cgcgccgtca acgagccggg cagcacgccg aacccgacgc gcttcatcta tctttcgaca       240
     cgcgtggacg gccagcacct gcgcatcgac aaatcgcgca tcgagccgcg cgcgacgacg       300
     ctgtttccgc gccgttggct ggagggcgac acggcgtgct ggtcgagcct ggaaggcgag       360
     cccggagcgg gctggcaact gagcgcatcg ggcgagcggc tcagctggac cgaagagggg       420
     ctcttcgaac tcggcggccc gctgcttggc cagggcatgc aatggtatct gcccggagtc       480
     gactggggca cgttctacgt ctcgcagatc tacgacatcg cgggcatctg cgacggccgg       540
     cgcgtgaagg ggctcatgtg cttcgaccag gcgtacatgg ccgagggcgg cgctatccac       600
     ttcagcaagg acctcgtggt caaccaccag atgcacgtga tctggtggtc gttcgcaacg       660
     gtctacaagg acggcagctg ggacgtgggc tcgttcatgg tcgggcatga ccatctgggc       720
     tacgcgatct tccagaacga caagggcgag attcgcacca ccaccgacat cgacggccgc       780
     gtgcagcaca aggacggcag ctatttcgtc gaaagcgcgc ggatcgtgct ggacggcgaa       840
     gaggagtggg agtttctgcc gtgtccgaag ggcgaaatga tcgactttgt cggcggattt       900
     ccgattaccg cgcagcagga aggccgctgg cggcgcgtcg gcgacacgcg cgaagcggat       960
     cgctgggtgg gctggggcga atcggatcgc cgcaacggca ccgcgcgcaa cgtgcgcggc      1020
     attcaaccct ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page