(data stored in SCRATCH zone)

EMBL: CP000272.PE611

CP000272.PE611       Location/Qualifiers
FT   CDS_pept        complement(665023..665808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36539"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HA0"
FT                   /protein_id="ABE36539.1"
FT                   /translation="MRPAARAGRLSHGTPRVTDQPIIVLVHGGQHRRTCWDPTVAALNT
FT                   LNPHAPVLAVDLPGHGNEPGDLARLTIAQCVESVLAQINASRASSGAKSVVLVGHSLAG
FT                   ITLPGVAAKLGTALKRMIFVACCIPPNGQCVLDTLGPPMNFIAKRAARREAVSAPLPAF
FT                   VASWVFGNGMTRDQKQQVIRGLCAESTKVTTEPVDRSMLPDVPRSWVLTKRDRALRPDL
FT                   QRRFIANLGGVDEVIELDTCHDAMISEPVELAQIILGRC"
     atgcgtcccg ccgcccgggc gggacgcctc tcccatggaa ctcctcgcgt gaccgaccag        60
     ccgatcatcg ttctcgtcca cggcggccag cacaggcgca cctgctggga ccccacggtc       120
     gccgcattga acacgctcaa tcctcacgcg ccggttctcg ccgtcgatct gccgggacac       180
     ggcaacgaac ccggcgacct ggcgcggctc acgatcgcgc aatgcgtcga gagcgtgctg       240
     gcgcaaatca acgcgtcacg tgcaagcagc ggcgcgaaaa gcgtcgtgct ggtggggcac       300
     tccctggcgg gcatcacgct gcccggcgtt gccgcgaagc tcggcacagc gctcaagcgg       360
     atgatcttcg tcgcatgctg cattccgccg aacggccagt gcgtgctcga cacgcttggg       420
     ccgccgatga atttcattgc gaagcgcgcg gcgcgccgcg aagccgtgag cgctccgcta       480
     ccggcgttcg tcgcgtcatg ggtgttcggc aacggcatga cgcgcgatca gaagcagcag       540
     gtgattcgcg gcctgtgtgc cgaaagcacg aaggtgacga ccgaaccggt ggaccgctcc       600
     atgttgccgg acgtaccaag gtcgtgggtg ctgacgaagc gcgatcgcgc gctgcgtccg       660
     gatctgcagc gcaggttcat cgccaacctg ggcggtgtgg acgaagtgat cgagctggac       720
     acctgccatg acgcgatgat cagcgaaccg gtcgaactcg cgcagatcat actcgggcgc       780
     tgctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page