(data stored in ACNUC7421 zone)

EMBL: CP000272.PE614

CP000272.PE614       Location/Qualifiers
FT   CDS_pept        complement(667493..668467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36542"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H97"
FT                   /protein_id="ABE36542.1"
FT                   /translation="MFDLLMTADMMVPDPDRMTELLVNKLGIHKHPNWRQAFDNHPYIA
FT                   HFLRVHKSLAVAPTRVEPQVHLDRPNPGDPLFHDFLKSLETYQGKHRPILTHSIVVASR
FT                   KPHFEQTVERLARLRQPFRLAQRTPEMPFDRLWVGVTPERPCYEPSVDGGLCIEIMPVE
FT                   PLQLPPETFAIPAPQPRDLQPGQLVRVTARGYLVRDLDDTLRRCSTNLGWDPAGPVEQL
FT                   DVEGYRRARMGFTLQNSASLDVIEPTRWNSDAGLYLNNWGPGPYFVRIAVNGLQVKAEE
FT                   LKSRGVRFDWIEACEAVGGRSLLRIHPSELDGQLFEFEEFQAP"
     atgttcgact tgctgatgac cgccgacatg atggttccag acccggaccg aatgacggaa        60
     ctgctggtca acaaactggg cattcacaag caccccaact ggcggcaggc gttcgacaac       120
     cacccgtaca tcgcgcattt cctgcgcgtg cacaagtcgc ttgcggtcgc gccgactcgc       180
     gtcgagccgc aggttcacct cgaccggccc aacccgggcg acccgctctt ccacgatttc       240
     ctgaagagcc tcgaaaccta ccagggcaag catcggccga tcctcacgca ttcgatcgtc       300
     gtcgcctcac gcaagccgca cttcgagcag acggtggagc gcctcgcacg cctgcgccag       360
     ccgttccggc tcgcgcagcg cacgccggag atgccgttcg accgcctgtg ggtcggcgtc       420
     acgccggaac gcccctgcta cgagccttcg gtggacggcg gcctgtgcat cgagatcatg       480
     ccggtcgagc cgctgcagct gccgcccgag acgttcgcga ttcccgcccc gcaaccgcgc       540
     gatctgcagc cgggccaact ggtgcgggta acggcgcgcg gctatctcgt gcgcgatctc       600
     gacgacacgc tgcgccgctg ctcgaccaat ctcggctggg acccggccgg cccggtcgag       660
     cagctcgacg tcgagggcta ccggcgcgcg cgcatgggct tcacgctgca gaacagcgcg       720
     tcgctcgacg tcatcgagcc gacccgctgg aacagcgacg cgggcctcta cctgaacaac       780
     tgggggccgg gtccgtactt cgtgcgcatt gccgtgaacg gtctgcaggt gaaggccgag       840
     gaactgaagt cgcgcggcgt ccgctttgac tggatcgaag catgcgaagc agtcggcgga       900
     cgctccctgc tccgcatcca tccttcagaa ctcgacggac agctcttcga attcgaagag       960
     ttccaggccc cctga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page