(data stored in ACNUC7421 zone)

EMBL: CP000272.PE616

CP000272.PE616       Location/Qualifiers
FT   CDS_pept        complement(671036..672127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0646"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36544"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H95"
FT                   /protein_id="ABE36544.1"
FT                   /translation="MFIRTLQRAAAVGLALIGACVPGLAAGSGKPAFVDPLDAPAAVAV
FT                   SPARQPMTAVAYAGSRLVAVGQRGVIVVSDNRGQTWRQVPSPVQSDLTAVTFPSATEGW
FT                   AVGHDGVILHSSNGGQTWVKQLDGRIANARFVAFYRAAAASGNTNAAPLLQQEERNAKA
FT                   GASLPWLDVWFDTPQRGYAVGSFGIVAVTTDGGKNWLPGLEYVDNPDFLNLNAIRGING
FT                   DIFIAGERGTVFRLDRSSGRFERLSSGYTGSFFGIAGNGKRLFAFGLRGTVYESTDRGD
FT                   TWQQARSGTDSSLNDAATLADGTVVICGSRALLLAGDPVTGELRRVSADTPMMFAGIAT
FT                   NGDGQVALSGSSGVMIESIPARR"
     atgtttatcc ggacgctgca acgcgcggca gctgtcggcc tggcgctcat cggcgcctgt        60
     gtgcccggcc tcgcggccgg aagcggcaaa cccgctttcg tcgatccact ggacgctccc       120
     gctgcggtgg ccgtctcgcc cgcacgccag ccgatgacag ccgtcgccta tgccggctcg       180
     cgcctcgtcg cggtcggcca gcggggcgtc atcgtcgtgt cggacaatcg cggccagacg       240
     tggcgccagg tgccgagccc ggtgcagagc gacctgacgg ccgtcacctt tccgagcgcc       300
     accgagggct gggcggtcgg ccatgacggc gtgatcctgc attcctcgaa cggcggccag       360
     acgtgggtca agcagctcga cgggcgcatc gcgaatgcgc gcttcgtcgc gttctatcgc       420
     gcggcggcgg catcgggcaa cacgaacgcc gctcccctgc tgcagcagga ggagcgcaat       480
     gcgaaagccg gggcatcgct gccctggctt gacgtatggt tcgacacgcc gcaacgcggc       540
     tacgcggtcg gctcgttcgg catcgtcgca gtcaccaccg acggcggcaa gaactggctg       600
     cccggcctcg agtacgtcga caaccccgac ttcctgaatc tcaacgccat tcgcggcatc       660
     aacggtgaca tcttcatcgc cggagaacgc ggcacggtgt tccggctcga ccggtcgagc       720
     ggccgcttcg agcgcctttc gtcgggctat accggcagct ttttcggcat cgccggaaac       780
     ggcaagcggc ttttcgcttt cggcttgcgc ggcacggtct atgaaagcac cgatcgcggc       840
     gacacctggc agcaggcgcg ctcgggcacc gactcgtcgc tgaacgacgc cgccacgctc       900
     gccgatggca ccgtcgtgat ctgcggcagc cgggcgctat tgctggcagg cgacccggtc       960
     acgggcgagc tgcgccgcgt gtcggccgat acgccgatga tgttcgccgg catcgccacg      1020
     aacggcgatg gacaggtcgc gctcagcggt tcgagcggcg tgatgatcga atcaatcccg      1080
     gcgcgccggt aa                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page