(data stored in ACNUC7421 zone)

EMBL: CP000272.PE624

CP000272.PE624       Location/Qualifiers
FT   CDS_pept        683727..684014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36552"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H87"
FT                   /protein_id="ABE36552.1"
FT                   /translation="MIRTWFSAHERGKAIGLFMTSSSFAVVVTDMSVPVMTQYLGWQNS
FT                   YRVLGATTIVRALHSRVLGMGECFNDQRSSRIHSGRGNRQCDFRSRSSCL"
     ttgattcgca cgtggttttc ggcgcacgag cgcggaaaag cgattggcct gttcatgacg        60
     tcgagttcgt ttgcggtcgt cgtgacggat atgagtgtac cggtgatgac gcaatatcta       120
     ggctggcaga attcataccg ggttcttggg gcaaccacaa tcgttcgagc actacacagt       180
     agggttcttg gcatgggcga atgctttaat gatcaaaggt catcacgtat ccacagtgga       240
     cgcgggaatc gtcagtgcga tttccggagc cggagcagtt gtctgtaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page