(data stored in ACNUC7421 zone)

EMBL: CP000272.PE64

CP000272.PE64        Location/Qualifiers
FT   CDS_pept        74087..74929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0065"
FT                   /product="ectoine-binding protein / hydroxyectoine-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35992"
FT                   /db_xref="GOA:Q13IU7"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR014337"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU7"
FT                   /protein_id="ABE35992.1"
FT                   /translation="MKLKGILITGTLSLLSLTSLAAVAQDKLAQLREQGFARIAIANEP
FT                   PFTAVGADGKVTGAAPDVARAVFRKLGVNDIVASISEYGAMIPGLAVGRHDAIAAGLFM
FT                   TPQRCAAVAYSQPVLCAVEAFAVKKGNTRSIKTYEEIAKDPKAVIGVEGGTTEQKLATA
FT                   AQIPAERVVIVPDGQSGLKMLQDGRIDAFALPLLSISDLLAKAKDANLESIAPVQGTPV
FT                   QCDGVAFRKQDTALRDAFDVELKKMKESGEFAKIVEPYGFSAKAAISTSRDKLCAATN"
     atgaaattga aggggattct gatcacgggg acgctgtcgc tgctgagctt gaccagcctt        60
     gcggccgtcg cgcaggacaa gctggcccag ctcagggagc agggcttcgc gcgcatcgcg       120
     attgccaacg aaccgccgtt cacggcggtc ggcgccgacg gcaaggtgac aggcgccgcg       180
     cccgacgtcg cgcgggcggt cttcaggaag ctcggcgtca acgatatcgt ggcgtcgatc       240
     tccgaatatg gcgcgatgat tcccggcctc gcggtgggac ggcatgacgc gatcgccgcg       300
     ggcctcttca tgacgccgca gcgctgcgcc gccgttgcct attcccagcc ggtgctgtgc       360
     gcggtggagg cctttgccgt caagaagggc aatacccgaa gcatcaagac ttacgaggaa       420
     atcgcgaaag atcccaaggc cgtgatcggc gtggaaggcg gcaccaccga acagaaactc       480
     gcgaccgccg cgcagattcc ggccgagcgg gtcgtgatcg tgccggacgg ccagagtggc       540
     ttgaaaatgc tgcaggacgg ccgcatcgac gcgtttgcgc tgcccctgct gtcgatcagc       600
     gatctgctcg cgaaagcgaa ggacgccaat ctggaatcga tcgcgccggt gcagggcacg       660
     cccgtgcaat gcgacggcgt tgcgttccgc aagcaggaca ccgcgctgcg cgatgcgttc       720
     gacgtcgagc tgaagaagat gaaggagtcg ggcgagttcg cgaagatcgt cgagccgtac       780
     ggattctcgg cgaaggcggc gatatccacg agtcgcgaca agctgtgcgc cgcgacgaac       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page