(data stored in ACNUC7421 zone)

EMBL: CP000272.PE645

CP000272.PE645       Location/Qualifiers
FT   CDS_pept        707152..707433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36573"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H66"
FT                   /protein_id="ABE36573.1"
FT                   /translation="MHREPRGVVSLGLLHSVHTIGNQSNQQQRIYQVALRCGECFVVVC
FT                   GCVDGDSWQALQPAPSLPCSNDFSKHRQLSRGAACVCVRLFLTFLRVP"
     atgcaccgag aaccgcgcgg agtggtcagc ttgggcctgt tgcattccgt tcacacgatc        60
     ggtaatcaat cgaaccagca gcagcgcatc taccaggtcg ctcttcggtg cggtgaatgc       120
     tttgtagtag tttgcggttg tgtcgacggt gattcgtggc aggcgctcca gcctgcgccg       180
     tccttgccat gttccaatga cttttccaag catcgtcagt tatccagagg tgctgcgtgc       240
     gtttgcgtgc gtttatttct tacgtttttg cgggtgccgt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page