(data stored in ACNUC7421 zone)

EMBL: CP000272.PE647

CP000272.PE647       Location/Qualifiers
FT   CDS_pept        complement(708061..708522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36575"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H64"
FT                   /protein_id="ABE36575.1"
FT                   /translation="MGGITMSAFWNTYPQFIDTNNLSLAVFIKYRWFKILFAGDLEKAG
FT                   WRALLQQASFRAELAGTEVLVASHHGRENGFCEDIFAYFTPSCVVISDKAIVHATQETV
FT                   PDYRAVVRKQGAYVNTTGKRRHVLTTRRDGWIQFTVLDNGYNIDTEYKG"
     atgggcggca tcaccatgtc ggcattctgg aacacctacc cgcagttcat tgacacgaac        60
     aacctgagtt tggcggtctt catcaagtac aggtggttca aaatcctctt tgcgggagat       120
     cttgaaaaag ctggttggcg cgcattgctg cagcaggcga gtttccgcgc tgagttggcg       180
     ggtacggaag tgctggtcgc atctcaccat ggccgggaga acggtttctg cgaggatatc       240
     ttcgcctact tcaccccgag ttgcgtcgtg atttcggaca aggcgatcgt gcacgccacg       300
     caggagacgg tgcccgacta ccgcgccgtc gttcgcaagc agggcgcgta cgtgaacacg       360
     accggaaaaa gacgtcatgt cctgacgaca cgccgcgatg gctggattca gttcaccgtt       420
     cttgacaacg gctacaacat cgacaccgag tacaagggat ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page