(data stored in ACNUC7421 zone)

EMBL: CP000272.PE648

CP000272.PE648       Location/Qualifiers
FT   CDS_pept        complement(708597..708929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36576"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H63"
FT                   /protein_id="ABE36576.1"
FT                   /translation="MPGEMRIRIWDVEHGACAMIQHVIQTGLGAQGGRLAMIDSGHGTS
FT                   FRPGEYITRTLGRNRLDYLFITNADEDHMSDLQGLWDAGIFVPVCTAIPARLRRRCASS
FT                   KSSVGH"
     atgccgggag aaatgcgcat tcgaatctgg gacgtcgagc atggcgcctg cgccatgatt        60
     cagcacgtca ttcaaacagg attaggtgcg cagggcggcc ggttggcgat gatcgattcg       120
     gggcatggca catcctttcg ccctggcgag tacatcacga ggactttggg gcgtaaccgg       180
     ctggactacc tgttcatcac gaacgccgat gaggaccaca tgagcgacct tcaggggctg       240
     tgggatgctg gcatctttgt gccagtgtgc accgcaatcc cagcccgtct gcggcgacga       300
     tgcgcgtcat caaagagcag tgtgggccac tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page