(data stored in ACNUC7421 zone)

EMBL: CP000272.PE649

CP000272.PE649       Location/Qualifiers
FT   CDS_pept        complement(708971..709408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0679"
FT                   /product="Putative plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36577"
FT                   /db_xref="GOA:Q13H62"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H62"
FT                   /protein_id="ABE36577.1"
FT                   /translation="MFVLDTNVVSELRKAKAGKADRNVAFWAASVSPGALFLSAITILE
FT                   FETGVLLMERRDATQGAILRAWLDSHVLPAFAGRVLAVDIAVAQRCARLHVPDQRAERD
FT                   ALIAATALVHGMTVVTRNVGDFVQTGVDILNPWEPIGIHHD"
     atgtttgttc tcgataccaa cgtcgtttca gaattgcgga aggcaaaagc cggcaaggcc        60
     gacaggaacg tggcattttg ggcagccagc gtatcgcctg gcgccctctt tctgtcggcc       120
     attacgatcc tggagtttga aaccggcgta cttctgatgg aacgtcgcga cgcaacgcaa       180
     ggcgccattc ttcgcgcctg gctggacagt catgtcctgc cggctttcgc cggccgtgtg       240
     ctggccgtcg atattgccgt cgcgcaacgc tgtgcaaggc ttcatgtgcc cgatcagcgc       300
     gcggagcgcg atgcactgat cgccgctaca gctcttgtgc atggcatgac ggttgtcaca       360
     cggaacgtag gcgacttcgt ccagacgggc gtcgacattc tcaatccatg ggagccgatc       420
     ggaatacacc atgattga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page