(data stored in ACNUC7421 zone)

EMBL: CP000272.PE651

CP000272.PE651       Location/Qualifiers
FT   CDS_pept        710006..710365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36579"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H60"
FT                   /protein_id="ABE36579.1"
FT                   /translation="MGTINRLLQQWKAGQARQTTAVLTLPPVQRVFDIVEDITGTRPAV
FT                   GTAPYFSDASALQPLINGAPTLILGPGELTAMHQTDEYCEVVKLRDAVRIYEALIHMSV
FT                   DADARLAALPAVAEE"
     atgggcacga tcaacaggct cctgcagcaa tggaaagcgg ggcaggctcg acagacaacg        60
     gccgtgctga cgctcccgcc tgtgcagcgc gtgttcgaca tcgtcgagga catcaccggc       120
     acacggcccg cggtgggtac cgccccatac ttctccgatg caagcgccct gcagccgctg       180
     atcaacggcg ccccgacgct gatcctgggc ccgggcgaac tgacggcgat gcaccagacc       240
     gacgagtact gcgaggtcgt caagctccgg gacgcggtgc gcatctacga ggccttgatc       300
     catatgagcg tcgacgctga cgcgcggctg gcggccttgc ccgccgtcgc cgaggaatag       360
//

If you have problems or comments...

PBIL Back to PBIL home page