(data stored in ACNUC7421 zone)

EMBL: CP000272.PE652

CP000272.PE652       Location/Qualifiers
FT   CDS_pept        710418..711446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36580"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H59"
FT                   /protein_id="ABE36580.1"
FT                   /translation="MSAQHSNASCLRAANVLLRDHFCTKPGENVVLTTDENSDTDLVRA
FT                   LADTAAALGAKTCVVDMPRLPFQGSLSDPYIPSPVEAAVMHSDVWLDLTFPYMAGSGAF
FT                   DRAMEHKRTRYLLVGDASAAGFARLYGSVDFDALFDLQEAADGFFREAQGKHCRVTSAA
FT                   GSDFSFVMGRPATRKDRRATQPGSQTIPGSAIFYPELETVKGKIVLEAAFHEYYTPLRE
FT                   PLVLEVDGRVRSVSGGSAAKVMDRALRRAGGGEYGNVIHLTVGLNPGAASTGRSFMEDI
FT                   RVIGCNAIGLGLPWWLPGGGENHPDGVVMNQSLWIGEQMIVENGLPTLAAPFSAEFEKL
FT                   VS"
     atgtccgccc aacactcgaa tgcctcctgc ctgcgtgccg cgaacgtgct gctgcgcgac        60
     cacttctgta cgaagccagg cgaaaacgtc gtgctcacca ctgacgaaaa ctccgacacg       120
     gacctcgtgc gagcgcttgc cgatacggcc gccgcgctcg gcgcgaagac atgtgtagtc       180
     gacatgcccc gcctgccatt ccaggggtcg ctgtcggacc cgtacattcc gtctccggtc       240
     gaggcggccg tgatgcatag cgatgtctgg ctcgacctga cgttccccta catggccggt       300
     tccggcgcgt tcgatcgcgc gatggagcac aagcgcaccc gctacctgct ggtcggcgat       360
     gcgagcgctg cgggtttcgc gcggctctat ggcagcgtcg atttcgacgc gctgttcgac       420
     cttcaggaag cagccgatgg tttcttccgg gaagcccaag gcaagcattg ccgcgtgaca       480
     tcggcggccg gcagcgactt ctcgttcgtg atgggacgcc ccgccacccg caaggaccgg       540
     cgcgcgacgc agccgggttc gcagaccata ccgggctcgg ccatcttcta tccggagctg       600
     gaaacggtta aaggaaagat cgtgctcgaa gccgcattcc acgaatacta cacaccactg       660
     cgcgagccac ttgtactcga ggtggatgga cgggtccgct ccgtcagcgg aggcagcgcg       720
     gcgaaggtga tggaccgcgc gctgcgccgc gcaggcggcg gtgaatacgg caatgtgatc       780
     cacctgacgg taggcctgaa tccgggcgcc gcgtccaccg ggcgctcgtt catggaagac       840
     atccgcgtaa taggctgcaa tgccatcggg cttggcctgc cctggtggtt gccgggcggc       900
     ggcgagaacc acccggatgg tgtcgtgatg aaccagtcgc tatggatcgg cgagcagatg       960
     atcgtcgaaa acgggttgcc cacgctggct gcgccgtttt cggctgaatt cgagaaactc      1020
     gtttcctga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page