(data stored in ACNUC7421 zone)

EMBL: CP000272.PE654

CP000272.PE654       Location/Qualifiers
FT   CDS_pept        712327..712992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0684"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36582"
FT                   /db_xref="GOA:Q13H57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H57"
FT                   /protein_id="ABE36582.1"
FT                   /translation="MNYHFHWGIVGQNLGYLLHGIWLTLAVTAVSLAVAIVIGLVIGIM
FT                   RISSKGVLKRVAGVYVEVFRNTPTLVQLIWVYYCLPVLTGINLSPTSSCIFALSINSAA
FT                   YVAEIFRAGIQAVPSGQLEAARSIGMSYSKAMRKIILPQAVRQMIPPFVNEFVSLLKYS
FT                   SLVSVLGVADLTYQAQTLSTTTFRPIEIFTFIGVVYFLLCWAISAAAHVLEQKIRVIA"
     atgaattatc attttcactg gggcatcgtt ggccagaacc tcgggtatct gctccacggc        60
     atatggctca cactcgctgt aacggccgtc tccctcgccg ttgccatcgt gatcggtctc       120
     gtcattggca tcatgaggat ttcctcaaaa ggcgtactca agcgagtggc aggcgtctat       180
     gtcgaggtgt tccgcaacac tccgacgctc gtccagctca tctgggtcta ttactgctta       240
     cccgtgctca caggcatcaa tctgagcccg acgagttcct gcatcttcgc gctgtcgatc       300
     aacagcgccg cgtatgtggc cgaaatcttc cgcgccggca tccaggctgt ccccagtggt       360
     cagcttgaag cggccagaag catcggtatg tcctattcga aggccatgcg caagatcatt       420
     ctgccgcagg ccgtccgaca gatgattccg ccgttcgtca acgaattcgt ctcgctgctc       480
     aagtattctt cgctcgtgtc ggtgctcggt gtagcggacc tgacctatca ggcacagacc       540
     ctcagcacga ccacgttccg gccgatcgag atatttacct ttatcggcgt cgtctatttt       600
     cttctatgct gggccatctc tgcggctgcg cacgttctcg aacagaaaat cagggtgatc       660
     gcatga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page