(data stored in SCRATCH zone)

EMBL: CP000272.PE655

CP000272.PE655       Location/Qualifiers
FT   CDS_pept        712989..713735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0685"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36583"
FT                   /db_xref="GOA:Q13H56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H56"
FT                   /protein_id="ABE36583.1"
FT                   /translation="MRHSPGDEPMVSIQGLKKRFGDHAVLKGVDLTVSKGEVLVIIGAS
FT                   GSGKSTLLRCINLMEVPDHGQVSVGGEPMGEMAGDGRFRMFPERIVNARRARIGMVFQH
FT                   FNLFAHLRVIDNVTIGPVEVNRMSRIDARELGMAMLEKVGMAAKADAFPSQLSGGQKQR
FT                   VAIARALAMRPRLILFDEPTSALDGGMPNRPETFYRQGSEKSPFRYPYFYPYSKGPVFP
FT                   LSRRSDPDFNPPKYGSNPNSTPPTDR"
     atgagacatt ctcccggcga cgaaccgatg gtctccattc agggattgaa aaaacgcttc        60
     ggcgatcacg ccgtgctcaa gggcgtcgac ctgaccgtta gcaaaggcga ggtgctcgtc       120
     attatcggcg cgagcggttc gggaaagagc acgctgcttc gctgcatcaa cctgatggaa       180
     gtcccggatc atgggcaggt tagcgtaggc ggcgagccga tgggcgaaat ggctggagac       240
     ggccggttcc ggatgtttcc ggagcggatc gtcaacgcac ggcgtgcgcg catcgggatg       300
     gtgttccagc acttcaacct gttcgcccac cttcgcgtca tcgacaacgt aaccatcggc       360
     ccagtcgaag tcaaccggat gagccgtatc gacgcgcgcg aacttggcat ggccatgctc       420
     gaaaaggtgg gtatggccgc aaaggctgat gcgttcccgt cgcaactgtc cggcggacag       480
     aagcagcgcg tcgcgatcgc acgggcactc gccatgcgcc cgcggctgat cctcttcgat       540
     gagcccacct cggcactcga cggagggatg ccaaatcgcc cggaaacctt ttacaggcaa       600
     ggctccgaaa aatcaccttt ccgctaccca tacttctacc catattcaaa aggacccgtt       660
     tttccgctgt ctaggaggtc cgatcccgat ttcaacccgc caaaatacgg ttcgaatccc       720
     aattcaacac cgcccacgga tcgatga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page