(data stored in ACNUC7421 zone)

EMBL: CP000272.PE666

CP000272.PE666       Location/Qualifiers
FT   CDS_pept        complement(724631..726628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0789"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0789"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36594"
FT                   /db_xref="GOA:Q13H45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H45"
FT                   /protein_id="ABE36594.1"
FT                   /translation="MKAHLFRRAHAAFMARSGGAPLPSSNLVEVRGLRVVGSRAGEPDT
FT                   TIVHDIDFEIARGEVLALIGESGSGKTTIALSLMGHARSGCRIAGGAIQVGDTDVLGLS
FT                   PIALADLRGRKVAYIAQSAAAAFNPARTIMDQVIESALIHGTLAKRAAQEKAVELFRAL
FT                   ALPEPETIGRRYPHQVSGGQLQRLMAAMALITDPELVILDEPTTALDVTTQIDVLQAFR
FT                   RVIRQCGMTAVYVSHDLAVVAQMADRIVVLSNGEIRETGRTEQILHAPAHPYTQSLIAA
FT                   VTPVMPDMPFAPVPAGTAATAVADGSALQPRPAAAPLLELRRLTAGYGGTNAKGWPNKV
FT                   ILNDVDLVIGRGQTVGVIGESGSGKTTLAKVIAGLVPMARGTLLLDGKPLAADLRRRSR
FT                   EQFRCIHIVFQNADTALNPTHTVERTLARPLKFYHGMKGDAAKRRVAELLNLVRLPAEL
FT                   AQRRTGELSGGQKQRVNLARALAAEPQLILCDEVTSALDTVVGAAILELLRDLQKKLGV
FT                   SYLFITHDIAKVRAISDDIVVLYAGHRVETGTRDALSAPPYHPYSHLLVSSAPELRAGW
FT                   LEEADERCHRALPPIGEATHEPELCTFLARCPMRIDGVCNRTAPTERTLASGAQVLCHR
FT                   SEAELEQYQSMPGDDAAAVAVLAESASVRG"
     atgaaggccc atcttttcag acgtgcccat gcggccttca tggccagatc gggcggcgcg        60
     ccgttgccgt cgtcgaatct cgtcgaggtg cgcgggttgc gcgtggtcgg cagccgtgcg       120
     ggcgagccgg atacgacgat tgtccacgac atcgacttcg agatcgcgcg cggcgaggtg       180
     ctcgcgctga tcggcgaatc cggctcgggc aagaccacga tcgcgctgtc gctgatgggc       240
     cacgcgcgca gcggctgccg gatcgcgggc ggcgcaatcc aggtcggcga caccgacgtg       300
     ctcgggttgt caccgatagc gctcgccgac ctgcgcggcc gcaaggtagc gtatatcgcg       360
     cagagcgcgg ccgccgcgtt caacccggcg cgcacgatca tggaccaggt gatcgaaagc       420
     gcgctgattc acggcacgct cgccaaacgc gcggcgcagg aaaaggcggt cgaactgttc       480
     cgggcgctcg ccctgccgga accggagacg atcgggcggc gctatccgca ccaggtatcg       540
     ggcggacagt tgcagcggtt gatggcggcg atggcgctga tcaccgatcc ggaactcgtg       600
     atcctcgacg aacccaccac ggcgctcgac gtgaccacgc agatcgacgt attgcaggcg       660
     ttccgccgcg tgatccgtca gtgcgggatg acggcggtct acgtgtcgca cgatctggcg       720
     gtggtcgcgc agatggcgga tcggatcgtc gtgctgagca acggcgagat tcgcgaaacg       780
     ggccgcacgg agcagattct gcatgcgccg gcgcatcctt atacgcagag cctgattgcc       840
     gcggttacgc cggttatgcc ggatatgccg tttgcgccgg tgccggcggg tacggccgcg       900
     accgcggtgg ctgacgggtc cgcgctgcaa cctcggccag ccgccgcgcc gctgctcgaa       960
     ctgcgccgtc tgaccgccgg ttacggcggc accaatgcga aaggctggcc gaacaaggtg      1020
     atcctgaacg acgtggacct cgtgatcggc cgcggacaga cggtcggcgt gatcggcgaa      1080
     tccggctcgg gcaagaccac actcgcgaag gtgatcgccg gactggtgcc gatggcgcgc      1140
     ggcacgctgc tgctcgacgg caagccgctg gcggccgacc tgcgccgtcg cagccgcgaa      1200
     cagttccgct gcatccacat cgtgttccaa aacgccgaca ccgcgctcaa cccgacccat      1260
     accgtggagc gcacgcttgc gcggccgctg aagttctatc acggcatgaa gggcgacgcc      1320
     gcgaagcgcc gcgtggccga actgctcaat ctcgtgcggc tgcccgccga actcgcccag      1380
     cgccgtaccg gcgaattgtc tggcggacag aagcagcgtg tgaatctggc gcgggcgctc      1440
     gccgccgaac cgcaactgat cctgtgcgac gaagtgacgt ccgcgctcga cacggtggtc      1500
     ggcgcggcga tcctcgaact gctgcgcgat ctgcagaaaa agctcggtgt gtcgtacctg      1560
     ttcatcacgc acgacattgc caaggtccgc gcgatcagcg atgacatcgt cgtgctgtat      1620
     gcggggcacc gggtcgagac tggcactcgc gacgcgctgt cggcaccgcc gtatcacccg      1680
     tattcgcatc tgctcgtgtc gtccgcgccg gagttgcgcg cggggtggct cgaggaagcg      1740
     gacgaacgtt gtcatcgcgc gctgccgccg attggcgaag cgacgcacga gccggagttg      1800
     tgcacgtttc tcgcgcgttg cccgatgcgg atcgacgggg tttgcaatcg caccgcgccg      1860
     accgagcgca cgctcgcgag cggcgcgcag gtgctgtgtc atcgcagcga ggcggaactg      1920
     gagcaatacc agagcatgcc gggcgatgac gcggcggccg tggccgtgct cgcggagtct      1980
     gcgagcgtgc ggggttga                                                    1998
//

If you have problems or comments...

PBIL Back to PBIL home page