(data stored in SCRATCH zone)

EMBL: CP000272.PE669

CP000272.PE669       Location/Qualifiers
FT   CDS_pept        complement(728685..730265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0786"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0786"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36597"
FT                   /db_xref="GOA:Q13H42"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H42"
FT                   /protein_id="ABE36597.1"
FT                   /translation="MYDDEIKKGGFSRRDMMRLLAAGGMLATGAGGLLAAANPAFAAPT
FT                   PKKGGKIRVAYDASSTADTLDPAKGSAGSDYIRFFMFYSSLTQLDASLTPQMNLAESVD
FT                   SSDAKVWVIKLRKGVIFHDGKALAPADVVYSLMRHKNPATASKVKTLADQFVDAKQTGP
FT                   NEVTLTLTSANADLPVILATPQFVIVKDGTTDFTTAVGTGPYKVKTFKPGVSTVGVRND
FT                   SFWKTGAGPYLDQIELIGIGDDAARVNALLSGDVHLINSVDPRSTQRISATPGYEVRET
FT                   KSGLYTDLIMRRDNPMSGNPDFVQGMKYLFDRDQVRSAVFRGYAVIGNDQPIPPGHRYF
FT                   NASLPQRPHDPDKAKFHFQKAGAIGTTLPPIYATTDANGSVEMGELLQQSAAKIGVNLN
FT                   INRVPADGYWSNHWMKHPLGFGSVNPRPSADVLFTQFFKSDAPWNESGWNNPKFDQLLG
FT                   AARSETDDAKRKQMYGDMQVLVSEHGGIGIPTFLSLLDANDKKLQGLAPVPTGAMMGFN
FT                   FAEYVWWNA"
     atgtacgacg acgaaatcaa aaagggcggt ttcagccgcc gtgacatgat gcgtttgctg        60
     gccgccggcg gcatgctcgc caccggtgcg ggaggcctgc tggcggcggc gaacccggcg       120
     ttcgccgcgc ccacgccgaa gaagggcggc aagatccggg tcgcctacga cgcatcgtct       180
     accgcggata cgctcgaccc ggccaagggc tcggccggct ccgactacat ccgcttcttc       240
     atgttctaca gcagcctgac gcagctcgac gcgtcgctga cgccgcagat gaaccttgcg       300
     gagtcggtgg acagcagcga cgcgaaggtg tgggtaatca agctgcgcaa gggcgtgatc       360
     ttccacgacg gcaaggcgct cgcgcccgcc gacgtggtct attcgctgat gcgccacaag       420
     aatccggcga ccgcgtcgaa ggtgaagacg ctcgccgacc agttcgtgga tgcgaagcag       480
     accggcccga acgaagtcac gctgacgctc acgtcggcca acgccgactt gccggtaatt       540
     ctcgctacgc cgcaattcgt gatcgtcaag gacggcacga ccgacttcac gacggcggtc       600
     ggcaccggcc cgtacaaggt gaagacgttc aagccgggcg tctcgacggt cggagtgcgc       660
     aacgacagct tctggaaaac gggcgcgggc ccctatctcg accagatcga actgatcggg       720
     atcggcgacg acgcggcgcg ggtcaatgcg ctgctctccg gcgacgttca tctgatcaat       780
     tccgtcgatc cgcgctcgac gcagcgcatt tcggcgacgc ccggctatga ggtgcgcgag       840
     accaagtcgg gcctctacac cgacctgatc atgcgccgcg acaatccgat gtcgggcaac       900
     cccgacttcg tgcaggggat gaagtatctg ttcgaccgcg accaggtgcg cagcgcggtg       960
     tttcgcggct atgcggtgat cggcaacgat cagccgattc caccgggaca ccgctatttc      1020
     aatgcgtcgc tgccgcagcg gccgcacgac ccggacaagg cgaagttcca cttccagaag      1080
     gcgggcgcga tcggcacgac gctgccgccg atctacgcga cgaccgacgc gaacggctcg      1140
     gtcgaaatgg gcgagctgct gcagcaaagc gccgcgaaga tcggcgtgaa tctgaacatc      1200
     aatcgtgtgc cggccgacgg gtactggtcg aatcactgga tgaagcatcc gcttggcttc      1260
     ggcagcgtca atccgcgccc cagcgccgac gtgctgttca cgcagttctt caagtcggac      1320
     gcgccgtgga acgagtcagg ctggaacaat ccgaagttcg accagttgct gggcgccgcc      1380
     cgttccgaaa cggacgacgc gaagcgcaag cagatgtacg gcgacatgca ggtgctggtg      1440
     tcggagcacg gcggcatcgg cattccgacc ttcctgagcc tgctcgatgc gaacgacaag      1500
     aagctgcaag gtctcgcacc ggtgccgact ggcgcgatga tgggcttcaa cttcgccgag      1560
     tacgtgtggt ggaacgcgtg a                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page