(data stored in SCRATCH zone)

EMBL: CP000272.PE676

CP000272.PE676       Location/Qualifiers
FT   CDS_pept        complement(737106..737417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0779"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0779"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36604"
FT                   /db_xref="GOA:Q13H35"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H35"
FT                   /protein_id="ABE36604.1"
FT                   /translation="MSGRFVRIGETARATVELTIDGEHVAALAGDTLLTAMLCSVRHVR
FT                   QSEFGNERRAGFCLMGACQDCWVWTADGERLRACTTVVEAGMRVVTTQPEAQWANLAS"
     atgagcggcc gcttcgtacg tatcggcgaa acggcgcgcg ccacagtcga attgacgatc        60
     gacggtgagc acgtcgccgc actcgccggc gacacgctgc tcaccgcgat gctgtgctcg       120
     gtgcgtcatg tgcggcaatc cgaattcggc aacgaaaggc gcgccggatt ctgcctgatg       180
     ggcgcatgtc aggattgctg ggtctggacg gcggacggcg agcgcttgcg cgcctgcacc       240
     accgtggtcg aagcgggcat gcgcgtcgtc acgacgcaac cggaggcgca atgggcgaac       300
     ctcgcatcgt ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page