(data stored in SCRATCH zone)

EMBL: CP000272.PE677

CP000272.PE677       Location/Qualifiers
FT   CDS_pept        complement(737414..738250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0778"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0778"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36605"
FT                   /db_xref="GOA:Q13H34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H34"
FT                   /protein_id="ABE36605.1"
FT                   /translation="MIEITNVHKSFGAVPVLKGISLNVRQGEVVCLIGASGSGKSTLLR
FT                   CINALESYDEGEIRLLGQPVEQRARNINQLRTQVGMVFQRFNLFPHRTALENVMEGPVH
FT                   VKRMPRADAQREASELLMKVGLGHKLHAYPNQLSGGQQQRVAIARSLAMKPKAILFDEP
FT                   TSALDPELVGEVLGVMRTLAREGMTMLVVTHEMGFAREVADRVCFLHAGLIIEEGTAQQ
FT                   VLGSPREARTREFLRHVLTNRSDGHDAHDGGAPAGGALSGGAHDDLAPGGVGGAAI"
     atgatcgaaa tcacgaatgt gcacaagagt tttggcgcgg tgccggtcct gaagggcatt        60
     tcgctgaacg tccgtcaggg cgaggtggtc tgcctgatcg gcgcgtcggg ctcgggcaag       120
     tcgacgctgc tgcgctgtat taacgcgctc gaatcgtacg acgaaggcga aatccgtctg       180
     ctcggccagc ctgtcgaaca acgcgcgcgc aacatcaacc agttgcgcac ccaggtcggc       240
     atggtgtttc agcgcttcaa tctgtttccg caccggaccg cgctcgaaaa cgtgatggaa       300
     ggaccggtgc atgtcaaacg catgccgcgc gccgatgcgc agcgcgaggc gtccgaactg       360
     ctgatgaagg tcgggctcgg ccacaagctg catgcgtatc cgaatcagtt gtcgggcggc       420
     cagcagcagc gggtggcgat tgcgcgttcg ctcgcgatga agccgaaggc gatcctgttc       480
     gacgagccga cctcggcgct cgatccggag ctggtcggcg aagtgctcgg cgtgatgcgc       540
     acgctcgcac gcgaaggtat gacgatgctg gtcgtcacgc acgaaatggg ttttgcgcgc       600
     gaagtggcgg acagggtctg ctttctgcat gcgggcctga tcatcgaaga aggcaccgcg       660
     cagcaggtgc tgggttcgcc gcgcgaggcg cgcacccgcg aattcctgcg ccatgtgctg       720
     accaatcgca gcgacgggca tgacgcgcat gacggcggcg cccccgctgg cggtgcgctc       780
     tccggcggcg cgcacgatga tttggcgccc ggcggcgtcg ggggagcggc gatatga          837
//

If you have problems or comments...

PBIL Back to PBIL home page