(data stored in ACNUC7421 zone)

EMBL: CP000272.PE678

CP000272.PE678       Location/Qualifiers
FT   CDS_pept        complement(738288..738944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0777"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0777"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36606"
FT                   /db_xref="GOA:Q13H33"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H33"
FT                   /protein_id="ABE36606.1"
FT                   /translation="MHWHDIVDFVPILIQGAVMSIVITLGCLLLSTVLGLTWALLKMSR
FT                   YPLVVRGVSTMINVVRGLPMIVLLFYIYFVLPEIHIQVSALQASIIGLGFGYSTYVAEI
FT                   FRAGIEAVDPGQYEAAQSIGMGRVKTMVRVILPQAIKVALPPYSNTLVMMLKDSSLAST
FT                   ITVAEMTREGQLIAASTFQNLTVYTLVAIGYLAMSLPLMSMTRTLERRFGRHKAR"
     atgcactggc acgatatagt cgactttgta ccgattctga ttcagggcgc ggtgatgagc        60
     attgtcatca cgctcggttg cctgctgttg agcacggtgc tcggactgac ctgggcgctg       120
     ctgaagatgt cgcgctaccc gctcgtcgtt cgcggcgtga gcacgatgat caacgtcgtg       180
     cgcggtctgc cgatgatcgt gctgctgttc tacatctact tcgtgctgcc cgagattcac       240
     attcaggtgt cggcattgca ggcgagcatt atcgggcttg gtttcggcta ctcgacgtat       300
     gtcgcggaaa ttttccgcgc cgggatcgag gcggttgatc ccggccagta cgaagccgcg       360
     cagtccatcg gcatgggccg cgtcaaaacg atggtgcgcg tgatcctgcc gcaggcaatc       420
     aaggtcgcgc tgccgccgta cagcaatacg ctcgtgatga tgctgaagga ctcgtcgctc       480
     gcctcgacca tcacggtcgc cgaaatgaca cgcgaagggc agttgatcgc ggcgtcgacg       540
     ttccagaatc tgacggttta tacgctcgtc gcgattggct atctggcgat gagcctgccg       600
     ctgatgagca tgacacgcac gctcgaacga cgtttcggtc ggcataaggc caggtaa          657
//

If you have problems or comments...

PBIL Back to PBIL home page