(data stored in ACNUC7421 zone)

EMBL: CP000272.PE683

CP000272.PE683       Location/Qualifiers
FT   CDS_pept        complement(744139..744753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0772"
FT                   /product="Transcriptional regulator, XRE family with Cupin
FT                   sensor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0772"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36611"
FT                   /db_xref="GOA:Q13H28"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H28"
FT                   /protein_id="ABE36611.1"
FT                   /translation="MQRTEAGKKRAVDLSHGDVGARLRALRVAQGLSVNELAMRAGVSV
FT                   GTVSQVERNKANPSVRILERLRQALEVPLTALLEEDDAVSDPITGDFVRKAAERPLFEV
FT                   GKNGMQKELLSPHGDHDLQMMIIMLPAGSGSEEVLVGIGEKAGLVLEGTVVLNVGDRRS
FT                   ELRAGDSFQFRSTVPHSVRNESNKTARLLWIMNTQPPVIHL"
     atgcagcgaa cagaagctgg caaaaaacgc gcggtcgacc tgagtcacgg cgacgtcggc        60
     gcccgtctgc gggcgctgcg cgtcgcgcag ggtctgtcgg tcaacgaact ggcgatgcgt       120
     gcgggcgtgt cggtcggcac cgtcagccag gtcgagcgca acaaggcgaa tccgtcggtg       180
     cgcattctcg aacgtctgcg tcaggcgctc gaagtgccgc tcaccgcgtt gctcgaagag       240
     gacgacgcgg tctcggaccc gatcaccggc gacttcgtgc gcaaggcggc cgagcggccg       300
     ctgttcgagg tcggcaagaa cggtatgcag aaagagttgc tgtcgccgca cggcgaccac       360
     gatctgcaga tgatgatcat catgctgccg gccggctcgg gttcggaaga agtgctggtc       420
     ggtatcggcg aaaaggccgg cctggtgctg gaaggcacgg tcgtgctgaa cgtcggcgat       480
     cgccgctccg aactgcgtgc gggcgacagt ttccagttca ggagtacggt gccacatagc       540
     gtgcgcaacg agagcaacaa gaccgcgcga ttgctgtgga tcatgaacac gcagccgccc       600
     gtcattcacc tctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page