(data stored in ACNUC7421 zone)

EMBL: CP000272.PE71

CP000272.PE71        Location/Qualifiers
FT   CDS_pept        complement(82059..82310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35999"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU0"
FT                   /protein_id="ABE35999.1"
FT                   /translation="MALQSFCENACLFRCRLPATDRIRGNCALASGTGFALLANAPVAS
FT                   ACRRCGGNPRPDGGRTPVFPESLVQSFMLRSTSKAHAG"
     atggcgctgc aatcattctg cgagaacgca tgcctttttc ggtgccggtt gcccgctaca        60
     gaccgcatcc ggggcaattg cgcattggca agcggtaccg gctttgcact tcttgccaac       120
     gcgccggtgg cttccgcttg ccgccgttgc ggcggcaacc cgcggcccga cggcggccgc       180
     acgcccgttt ttccggaaag cctcgtacaa tccttcatgc ttcgatcaac cagcaaggct       240
     catgcaggat ag                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page