(data stored in ACNUC7421 zone)

EMBL: CP000272.PE72

CP000272.PE72        Location/Qualifiers
FT   CDS_pept        82361..82870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0074"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36000"
FT                   /db_xref="GOA:Q13IT9"
FT                   /db_xref="InterPro:IPR007251"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT9"
FT                   /protein_id="ABE36000.1"
FT                   /translation="MPTKPVVPAPTDELDTVPDTSSPAYATHHPLTRAFDRFASLVTRW
FT                   AGSPAAFCLAVLTVLAWVVTGPIFHYSEGWQLVINTGTTIITFLMVFLIQQSQNKDSVA
FT                   LHLKLNELLSSHRAASNHLIGIEDASEEELRRLAAAYLRLSTKPDTGTAAGGSLTPERT
FT                   GPPTDS"
     atgcctacca aacccgtcgt tcccgcgcca accgacgaac tcgacaccgt tccggataca        60
     tcaagccccg cttacgcaac ccatcatccg ctcacccgcg cgttcgaccg gtttgcaagt       120
     ctcgtcaccc gctgggcggg atcgccagcc gccttctgtc ttgccgtatt gacggtgctc       180
     gcctgggtcg tcacggggcc gatttttcac tattccgagg gatggcaact ggtcatcaac       240
     accggtacca ccatcattac ctttctgatg gtcttcctga tccagcagag tcagaacaag       300
     gacagcgtcg cgctgcatct caagctgaat gaactgcttt cctcccacag ggcggcaagc       360
     aaccatctga tcggcatcga ggacgcgtcg gaggaagaac tgcggaggct ggcggccgcc       420
     tatctgcgtc tatcgaccaa gcccgatacc gggacggccg ccggcggctc cctcactcct       480
     gagcggacgg ggccaccgac ggatagctga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page