(data stored in ACNUC7421 zone)

EMBL: CP000272.PE73

CP000272.PE73        Location/Qualifiers
FT   CDS_pept        82954..84057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0075"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36001"
FT                   /db_xref="GOA:Q13IT8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT8"
FT                   /protein_id="ABE36001.1"
FT                   /translation="MSSNSKQSSDYPAVEVRKGQVTEKMPREAFRERFMARFYDPAFRA
FT                   EDDALGRLEAIAWDAYCNARKSPVTAKAGPGFADPDYDLSVEWRAASERVKAAQIRQQE
FT                   RATPSRVLIVNASSRNDYTCPGEMSKSFRLGKLAQETLERKACEVDFLDLSLLNSEHDL
FT                   HIHPCKGCVSTAMPLCHWPCSCYPNHSLGLVNDWMNEIYERFAACHGVLFVTPVYWYQV
FT                   SSPLKLLMDRLVCADGGNPDPTSTHGKQADEAKRLELAGWDYPKHLAGRAYGIVVHGDV
FT                   AGIEGSRRALTDWLNWMGFIEAGAKSRLDRFIGYYEPYATSHATLDRDADMQKEVVNVA
FT                   EAVALCVAQIRNGRKEPDEHLEPARAK"
     atgagctcaa attcaaagca gtcctccgac tatccggcag tcgaagtccg taaaggacag        60
     gtgacagaaa agatgccgcg cgaagcgttt cgcgagcgtt tcatggcgcg tttctacgac       120
     cccgcgttcc gggcggaaga cgacgcgctc ggccgcctcg aggcgatcgc gtgggatgcc       180
     tattgcaacg cgcgcaaatc gcctgtcacc gcgaaagccg ggcctggatt cgcggacccc       240
     gactacgatc tgtcagtcga atggcgcgcg gcgagtgagc gggtcaaggc cgcccagatc       300
     cggcaacagg agcgcgcgac gccttcgcgc gtgctgatag tcaacgcttc gtcgcgaaac       360
     gactacacgt gccctggcga aatgtcgaag agcttccggc tcggcaaact cgcgcaggaa       420
     acgttggagc gcaaagcctg cgaggtcgat ttccttgatc tgtcgcttct gaactccgag       480
     cacgatctgc atattcaccc ttgcaaaggc tgcgtttcga cggcgatgcc gctgtgccac       540
     tggccgtgca gctgctatcc gaaccactcg ttgggtctcg tgaacgactg gatgaacgag       600
     atctacgaac gttttgcggc gtgtcacggc gtattgttcg ttaccccggt ctactggtat       660
     caggtaagca gcccgctcaa gctcttgatg gaccgtctcg tctgcgcgga cggcggcaat       720
     cccgacccca cctcgacgca tggcaaacag gccgatgaag cgaagcggct cgaactcgcg       780
     ggatgggatt atccgaagca tctggcgggc agagcgtatg gcatcgtcgt gcatggagat       840
     gtggccggta tagagggctc ccgccgggcg ctgaccgact ggctcaactg gatgggcttc       900
     atcgaagccg gtgcgaagtc gcgtctggac cgttttatcg gctattacga accctatgcg       960
     acgagtcacg ccacgctcga tcgcgacgct gacatgcaga aagaggtcgt caacgttgcc      1020
     gaggcggtcg ccctctgcgt cgcccagatc cgcaatggac gcaaggagcc ggacgagcat      1080
     ctcgaacccg cgcgcgccaa gtga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page