(data stored in ACNUC7421 zone)

EMBL: CP000272.PE77

CP000272.PE77        Location/Qualifiers
FT   CDS_pept        88074..89102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0079"
FT                   /product="Putative cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36005"
FT                   /db_xref="GOA:Q13IT4"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT4"
FT                   /protein_id="ABE36005.1"
FT                   /translation="MRGLRTGAGSFALILALAASPVHAGPAAPLNYFLHAAGPAAAPTQ
FT                   RLGWVLSAIAILVTLIIAGLLVGAIVRRRPAPPTRPFNAEAGGMHWIYIGTGVSSIVLL
FT                   AILVYVLITLESVASPAAHPQLTLTVTAYDWWWKVDYADDPDPLRNFSTANEIHIPVGQ
FT                   PVKILLKSADVVHAFWVPQLAGKTQTIPGQTNEQWIQADQPGIFRGQCSQFCGAQHAHM
FT                   AFEVVAQSPADFAAWRAAQGRTAGGSAGDAAVAAGRHLFAERCAGCHTIRGSDAAGLQA
FT                   PDLTHLLSRRTLAAGALTNTPEHLLDWIEHAQRIKPEALMPDIPLTTGDAAALSAYLAT
FT                   LH"
     atgcgaggtc tgcgcaccgg agccggtagc ttcgccctga tactcgcgct tgcggcgagt        60
     cccgtgcatg ccggcccggc ggcccccctc aattactttc tccacgccgc cggtccggcg       120
     gccgcgccga cccagcggct gggctgggtg ctgagcgcca tcgcgatact cgtgacgctc       180
     atcattgccg ggttgctggt cggcgcgatc gtccgccggc gcccagcgcc gccgacgcgg       240
     ccattcaacg ccgaagctgg cggcatgcac tggatttaca tcggcacggg cgtgtcttcg       300
     attgtcttgc tggcgatact cgtctacgtc ctcatcacgc tcgaatcggt tgcttcgccg       360
     gccgcgcatc cgcaactgac cctcaccgtc accgcctacg actggtggtg gaaagtcgac       420
     tatgcggacg accccgaccc gctccgcaat ttcagcacgg caaacgagat tcacattccc       480
     gtcggccagc cggtaaaaat cctgctgaaa agcgcggacg tggttcacgc gttctgggtg       540
     ccgcaactgg ccggaaagac ccaaacgatt cccggacaaa ccaacgagca gtggattcag       600
     gccgaccagc ccggcatttt tcgcgggcaa tgctcgcaat tttgcggcgc gcagcacgcg       660
     catatggcct tcgaagtggt tgcgcagagc ccggcggact tcgctgcgtg gcgcgccgcg       720
     caggggcgca cggcgggtgg ctccgcgggc gatgccgcgg tcgcggcggg gcggcatctg       780
     ttcgccgagc gctgcgcggg ctgccacacg attcgcggca gcgacgccgc tggtctgcaa       840
     gcgccggatc tgacgcatct gctgtcgcgc cgcacgctcg ccgccggcgc gctgaccaat       900
     acgccggagc atctgctcga ctggatcgaa cacgcgcagc gcatcaaacc ggaagcgttg       960
     atgccggata tccccctgac aaccggcgac gccgccgcgc tgtcagccta tctggcgacg      1020
     ctgcattga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page