(data stored in SCRATCH zone)

EMBL: CP000272.PE79

CP000272.PE79        Location/Qualifiers
FT   CDS_pept        91176..91829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0081"
FT                   /product="Putative cytochrome c oxidase subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36007"
FT                   /db_xref="GOA:Q13IT2"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT2"
FT                   /protein_id="ABE36007.1"
FT                   /translation="MSDAIDLNQPSDGSTEPMLALPVGSAGERSGGWWGCLTLIATEGA
FT                   LFGYLIFSYLYLASQSPQHWPPEGLPKLGLGIANTIILLSSSGFVWLCERCVRRGRLRW
FT                   AVASMAVGIVLGCLFVGIQLLEWRDHPYGLTTHLYGSLYFTITGFHMAHVVVGIVVLLL
FT                   LLLWTALGYFDAKRCAALTIGGLYWHFVDVVWLFIFSTLYLTPYLFQGWSWQRA"
     atgagcgacg ccatcgatct gaaccagcca tcggacggct ccactgaacc catgcttgcc        60
     ttacccgtgg ggagcgccgg cgagcgctcg ggcggctggt ggggctgcct cacgctgatc       120
     gccaccgaag gcgcgctgtt cggctatctg atcttttcgt atctgtatct ggcctcgcaa       180
     agcccgcagc attggccgcc tgaagggttg ccgaaactcg gccttggcat tgcgaacacg       240
     atcattctgc tgtcgagcag cgggttcgtc tggctgtgcg agcgctgtgt gcggcgcggg       300
     cgcttgcggt gggccgtggc gtcgatggcg gtgggcatcg tgctcggctg cctgttcgtg       360
     ggcatccagc tgctcgaatg gcgcgatcat ccgtatggct tgaccaccca tctttacggc       420
     tcgctgtact tcaccattac cgggtttcac atggcgcacg ttgtggtagg catcgtcgtg       480
     ctgctgcttc tgctgctatg gaccgcgctg ggttatttcg acgcaaaacg ttgcgccgcg       540
     ttgacgatcg gcggcctgta ctggcatttt gtcgacgtgg tgtggctgtt cattttcagc       600
     acgctgtatt tgacgcctta cctattccag gggtggtcat ggcagagagc gtga             654
//

If you have problems or comments...

PBIL Back to PBIL home page