(data stored in ACNUC7421 zone)

EMBL: CP000272.PE80

CP000272.PE80        Location/Qualifiers
FT   CDS_pept        91814..92239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0082"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36008"
FT                   /db_xref="GOA:Q13IT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT1"
FT                   /protein_id="ABE36008.1"
FT                   /translation="MAESVTSPEAPHSPLRYALAGLLLAPLAWLVQMVIAETLAAQSCY
FT                   PFDVPLSAPAMPWMRPALVGVSALCLAAGASGAVIAWRNLRRIARMEKSASGNARPTRT
FT                   ELAGFLSRIAAMCSALFLFALIATDVALAIVSPCRWW"
     atggcagaga gcgtgacatc gcccgaagcg ccgcattcac cgctgcggta tgcgctcgcc        60
     ggcctgctgc tcgcaccgct tgcctggctt gtacagatgg tgatcgccga gaccctggcc       120
     gcccagagct gttatccgtt cgacgtgccg ctgtccgcac cggccatgcc gtggatgcgt       180
     ccggcgctcg tcggggtcag cgcgctgtgt ctggcggcgg gcgcgagcgg cgccgtgatc       240
     gcgtggcgca atctgcgccg gatcgcgcga atggagaaga gcgcgtccgg caacgcgcgt       300
     cctacgcgaa cagaactcgc gggcttcctg agccggatcg ccgcgatgtg tagcgcgcta       360
     ttcctgttcg cgctgattgc gaccgacgtc gctttggcaa tcgtctcgcc atgccggtgg       420
     tggtga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page