(data stored in SCRATCH zone)

EMBL: CP000272.PE85

CP000272.PE85        Location/Qualifiers
FT   CDS_pept        complement(97921..98943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0087"
FT                   /product="ABC taurine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36013"
FT                   /db_xref="GOA:Q13IS6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS6"
FT                   /protein_id="ABE36013.1"
FT                   /translation="MKPLLSSLRTAAAGLTLFTLMAGAVHAESREVVIGYQDMVVPWRY
FT                   AQVSGAVEKATGYKVTYRKLAGGADVIRALASGSIQLGEAGSSPIAAGLSQGVDISLFW
FT                   ILDNINDAEALVARNGSGVTKLTDLKGRKIGLPFVSTSHFHALVALQDAGVDPSTVKIL
FT                   NLRPPEVAAAWERGDIDATYIWDPVLAKVKKNGKVLITSGEVARESGKATFDGFAVNRK
FT                   FAQDNGAFLVGLVKVLADTDAQYRDHKAAWTVGSKEVEGVAQESGANAADVPASLALYA
FT                   FPTLAEQASPTWLGGGAQSGAAKSLAATAAFLKSQGTIQNVLPDYSAGVDPRFVQQAAK
FT                   "
     atgaaaccac tactctcctc gctgcgaacc gccgctgccg gcctcaccct cttcaccctg        60
     atggccggcg cggtgcacgc cgagtcacgc gaagtcgtga tcggctacca ggacatggtg       120
     gttccatggc gctacgcgca ggtgagcggt gcagtcgaaa aagcgaccgg ctacaaggtg       180
     acctaccgca agctcgcggg cggcgccgac gtgatccgcg cgctcgcgtc gggctcgatc       240
     cagctcggcg aggccggctc aagccccatc gcggcagggc tgtcgcaagg cgtggacatt       300
     tcgctgttct ggattctcga caacatcaac gacgccgaag cgctagtggc aagaaacggc       360
     tccggcgtga cgaagctgac cgatctcaag ggccggaaga tcggcttgcc attcgtgtcg       420
     acttcgcatt tccatgcgct cgtcgcactg caagatgccg gggtggatcc gtcgacggtc       480
     aagatcctca acctgcgccc gccagaagtc gcggcggcgt gggagcgcgg cgacatcgac       540
     gcgacctaca tctgggaccc ggtactcgcg aaggtgaaga agaacggcaa ggtgctgatc       600
     acgtcaggtg aagtcgcacg ggaatcgggc aaggcgacct tcgacggctt cgcggtgaat       660
     cgcaaatttg cgcaggacaa cggcgcgttt ctcgtcggtc tcgtcaaggt actggccgac       720
     acggatgccc agtatcgcga tcacaaagcc gcgtggacgg tggggtcgaa ggaagtcgag       780
     ggcgtggcgc aggaatcggg cgcgaatgcc gccgacgtcc ccgcaagcct cgcactctac       840
     gcgttcccga cccttgcgga acaggcgtcg ccgacctggc ttggcggcgg agcgcaaagc       900
     ggcgccgcga agtctctggc cgcgacggcg gcgttcctca agtcgcaggg cacgatccag       960
     aacgtgttgc ctgactattc ggcgggcgtc gatccccgct tcgtgcagca agcggcaaaa      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page